Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|035830
Gene name
Locationscaffold_13:587233..588426
Strand-
Gene length (bp)1193
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 1.8E-13 42 229

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5PQ59|ALKB6_XENLA Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6 OS=Xenopus laevis GN=alkbh6 PE=2 SV=1 3 235 7.0E-45
sp|Q8K2U2|ALKB6_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6 OS=Mus musculus GN=Alkbh6 PE=2 SV=3 3 237 1.0E-42
sp|Q3KRA9|ALKB6_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6 OS=Homo sapiens GN=ALKBH6 PE=1 SV=2 3 237 8.0E-42
sp|Q6IQE9|ALKB6_DANRE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6 OS=Danio rerio GN=alkbh6 PE=2 SV=1 3 240 1.0E-39
sp|Q5UR03|YL905_MIMIV Uncharacterized protein L905 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L905 PE=3 SV=1 3 172 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|035830
MVLTEEEEKYIIRKIHDSPQQKWKQLANRRLQIWGGEITAKGLLPQSLPPYALNYPNLLDRLKETGAFLESPHGS
PNHIILNEYRAGQGIMPHEDGPKYFPVVATISLGSHTVFNYYRYKPNHPEPGDSEGKIVDKIPMMSLLLEPRSVV
ISSGEMYTGYLHGIDPVEEDHLLPSNASQPSEDDPEDSESTITWTTIDNWSLLGDEHTKHLVTSGSILKRGTRYS
LTCRDVERVFSAKSFRFTR*
Coding >AgabiH97|035830
ATGGTTCTCACCGAGGAAGAGGAAAAGTATATCATACGCAAAATACACGACTCTCCTCAACAAAAATGGAAGCAA
CTGGCAAATCGAAGGCTGCAAATATGGGGTGGGGAAATCACTGCGAAGGGGCTTCTTCCTCAAAGTCTTCCGCCG
TACGCGTTGAATTACCCAAACCTTCTCGACCGTCTCAAGGAAACTGGGGCCTTTCTTGAGTCGCCTCATGGAAGC
CCTAATCATATCATTCTCAACGAGTATCGGGCTGGGCAGGGAATAATGCCTCATGAAGATGGTCCGAAGTACTTT
CCTGTAGTAGCTACCATCTCGCTGGGATCTCACACGGTATTTAATTACTACCGATACAAACCGAACCATCCAGAG
CCAGGGGACAGCGAAGGAAAGATTGTTGACAAGATCCCTATGATGTCCCTTCTTCTCGAGCCTCGCAGTGTAGTC
ATATCTTCGGGTGAGATGTACACAGGTTACCTGCACGGTATAGACCCTGTCGAGGAGGACCACCTCCTTCCATCA
AACGCTTCACAACCCAGCGAAGATGATCCTGAAGATTCCGAGTCAACAATTACTTGGACTACGATCGACAACTGG
TCCCTCCTTGGAGACGAGCATACGAAACACTTAGTCACGAGTGGTAGTATCCTCAAGCGGGGGACTAGATATAGT
TTGACCTGTCGAGACGTGGAGCGCGTTTTCTCCGCCAAATCTTTCAGATTCACTCGATAG
Transcript >AgabiH97|035830
ATGGTTCTCACCGAGGAAGAGGAAAAGTATATCATACGCAAAATACACGACTCTCCTCAACAAAAATGGAAGCAA
CTGGCAAATCGAAGGCTGCAAATATGGGGTGGGGAAATCACTGCGAAGGGGCTTCTTCCTCAAAGTCTTCCGCCG
TACGCGTTGAATTACCCAAACCTTCTCGACCGTCTCAAGGAAACTGGGGCCTTTCTTGAGTCGCCTCATGGAAGC
CCTAATCATATCATTCTCAACGAGTATCGGGCTGGGCAGGGAATAATGCCTCATGAAGATGGTCCGAAGTACTTT
CCTGTAGTAGCTACCATCTCGCTGGGATCTCACACGGTATTTAATTACTACCGATACAAACCGAACCATCCAGAG
CCAGGGGACAGCGAAGGAAAGATTGTTGACAAGATCCCTATGATGTCCCTTCTTCTCGAGCCTCGCAGTGTAGTC
ATATCTTCGGGTGAGATGTACACAGGTTACCTGCACGGTATAGACCCTGTCGAGGAGGACCACCTCCTTCCATCA
AACGCTTCACAACCCAGCGAAGATGATCCTGAAGATTCCGAGTCAACAATTACTTGGACTACGATCGACAACTGG
TCCCTCCTTGGAGACGAGCATACGAAACACTTAGTCACGAGTGGTAGTATCCTCAAGCGGGGGACTAGATATAGT
TTGACCTGTCGAGACGTGGAGCGCGTTTTCTCCGCCAAATCTTTCAGATTCACTCGATAG
Gene >AgabiH97|035830
ATGGTTCTCACCGTGTGGGCGATCGTGATGTGATCTACATTCCCAACTTCCTTTCGGTCGGTAAACTTAGAGTCT
TCCTTCGTCTTGGATGAATTGATTTCTATTGATTGTAGGAGGAAGAGGAAAAGTATATCATACGCAAAGCCAGTG
TCTTATTATCATGGTTTTCTTATTTGATTCCAATCTCTCTTTTTAGATACACGACTCTCCTCAACAAAAATGGAA
GCAACTGGCAAATCGAAGGTAACGCTCTGAAGCTCCGCGACGGAGACAATCTCCTTAAACCCTATTAGGCTGCAA
ATATGGGGTTTGAATCAGAGACCTTCTGGTGTCGTGATACTTATCTAACCCGGCCAGGTGGGGAAATCACTGCGA
AGGGGCTTCTTCCTCAAAGTCTTCCGCCGTACGCGTTGAATTAGTGAGGATATATTCAACCCTCGCTTCCGCGTT
CTACTCTTGACTAGTTCCAGCCCAAACCTTCTCGACCGTCTCAAGGAAACTGGGGCCTTTCTTGAGTCGCCTCAT
GGAAGCCCTAATCATATCATTCTCAACGAGGTCTGAATCATATGCGGCTCTGTCACTCAAAGCTGATTCAATCGT
GTAGTATCGGGCTGGGCAGGGAATAATGGTTAGCGTCTAAGTTTCGCCTTCCAAATGGTGGCTCCTTGAATTTGT
TTCCACAGCCTCATGAAGATGGTCCGAAGTACTTTCCTGTAGTAGCTACCATCTCGCTGGGATCTCACACGGTAT
TTAATTACTACCGATACAAACCGAACCATCCAGAGCCAGGGGACAGCGAAGGAAAGATTGTTGACAAGATCCCTA
TGATGTCCCTTCTTCTCGAGCCTCGCAGTGTAGTCATATCTTCGGGTGAGATGTACACAGGTTACCTGCACGGGT
GAGTAGGGTCTTATAATTGTATACTGAAACATTTATTGTAAGACAGTATAGACCCTGTCGAGGAGGACCACCTCC
TTCCATCAAACGCTTCACAACCCAGCGAAGATGATCCTGAAGATTCCGAGTCAACAATTACTTGGACTACGATCG
ACAACTGGTCCCTCCTTGGAGACGAGCATACGAAACACTTAGTCACGAGTGGTAGTATCCTCAAGCGGGGGACTA
GATATAGTTTGACCTGTCGAGACGTGGAGCGCGTTTTCTCCGCCAAATCTTTCAGATTCACTCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail