Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|035720
Gene name
Locationscaffold_13:549058..552255
Strand+
Gene length (bp)3197
Transcript length (bp)2214
Coding sequence length (bp)2214
Protein length (aa) 738

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03659 Glyco_hydro_71 Glycosyl hydrolase family 71 4.4E-106 57 418
PF01822 WSC WSC domain 1.3E-17 515 598
PF01822 WSC WSC domain 5.3E-17 626 706

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13716|AGN1_SCHPO Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn1 PE=1 SV=2 55 441 2.0E-72
sp|B6GX22|MU71A_PENRW Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=PCH_Pc12g07500 PE=1 SV=1 51 448 2.0E-48
sp|O94510|AGN2_SCHPO Glucan endo-1,3-alpha-glucosidase agn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn2 PE=2 SV=2 55 437 6.0E-33
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 508 713 1.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 512 713 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13716|AGN1_SCHPO Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn1 PE=1 SV=2 55 441 2.0E-72
sp|B6GX22|MU71A_PENRW Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=PCH_Pc12g07500 PE=1 SV=1 51 448 2.0E-48
sp|O94510|AGN2_SCHPO Glucan endo-1,3-alpha-glucosidase agn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agn2 PE=2 SV=2 55 437 6.0E-33
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 508 713 1.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 512 713 2.0E-24
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 467 714 3.0E-21
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 505 714 3.0E-20
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 511 723 6.0E-16
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 514 723 2.0E-15
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 515 695 1.0E-13
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 514 723 4.0E-13
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 515 692 8.0E-12
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 612 715 9.0E-12
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 515 699 1.0E-11
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 515 692 2.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 612 720 2.0E-11
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 623 717 3.0E-11
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 612 715 5.0E-11
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 516 607 2.0E-09
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 626 723 3.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 609 713 3.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 498 607 6.0E-09
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 620 713 1.0E-08
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 624 714 3.0E-08
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 627 714 8.0E-08
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 513 608 7.0E-07
sp|Q965Q8|XYLT_CAEEL Xylosyltransferase sqv-6 OS=Caenorhabditis elegans GN=sqv-6 PE=1 SV=3 610 720 1.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 515 605 1.0E-06
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 515 605 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051118 glucan endo-1,3-alpha-glucosidase activity Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0003674 molecular_function No
GO:0015926 glucosidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|035720
MRSVPFFISFLTILGLTEAGLLPHLFLKQAQSRGYADFLPRRSNSTLQPRRSDPKYVFMHHIVGSTYDYTIDDWK
SDIQEIGSGGVDAIALNFGSDYWENEQLHNAYDAGSGSGVKLFLSFDFSVFPCDVNSVVNLVNQFAQHESQFKVD
GRPLISSFLGACLGSQGWQEIKDRTGGYLMPFIEGIEGQFGNWNCLDSWYCWGCAWPQGDVNKTTADDRYYISQM
GSSTKYAATISPWIFTHYDYKNFYQRGDDWLIVSRWEQLIEMRDQLPMVEMVTWNDFGESSYFGHVKGVQPSGTT
WADGYSHLPFFELSKYYITAFKTGHYPAINQDVIYFWARPHPAEAAASVDALARPQGYNFAEDSLWALAFATQSG
QVTLTCGTSTQQFTVNPGINKLKLPLSPGQITVSMSRDGKRIINKSPSDFTYNASPDLYNYNVYVGSAKAGPGQS
VPETMSTGSATHLSSTYSTSATQTPSSMITSAGQDSTTPTLSRTTSSYVSISTQAPTPTGGSWQYVGCVAEGTTG
PRRALSGASYSKSDMTPEKCQTLCAGYTFAGVEYGQECYCGNTLTNNGASGNVISPNECSLPCMGDPSKSCGGVW
TLNVYTTLSNIPSNTHPSTHNGWESLGCYIDSTDRLLKGFFTIKPGMTAATCVAECSDHGFIYAATEYGVECHCG
NQIESYGSGVSVDGSQCNMACDGDPSTKCGGSWRANVYRISAKSSRSLVSQKHHVSRKKKHH*
Coding >AgabiH97|035720
ATGAGATCCGTTCCGTTCTTTATCTCTTTTCTGACAATTCTGGGGCTCACAGAGGCTGGCCTTTTGCCCCACCTC
TTTCTGAAGCAAGCTCAATCGCGTGGATATGCGGATTTCCTACCAAGACGATCAAATTCAACCTTACAGCCTCGC
CGCAGCGATCCCAAATATGTTTTCATGCACCACATTGTTGGAAGTACATATGACTACACCATCGATGATTGGAAG
AGCGATATTCAAGAGATAGGTTCGGGAGGGGTCGACGCTATCGCGCTCAACTTTGGTTCTGATTATTGGGAGAAT
GAACAGCTCCATAACGCTTATGATGCTGGTTCTGGCTCTGGTGTCAAGCTTTTCTTATCCTTCGACTTCAGTGTG
TTTCCATGCGACGTAAACTCTGTTGTCAACCTTGTCAATCAATTTGCCCAACATGAAAGCCAGTTTAAAGTTGAC
GGGCGCCCGCTCATATCTTCCTTTTTGGGTGCTTGCCTAGGCAGTCAGGGCTGGCAGGAGATTAAGGATAGAACA
GGCGGATACTTAATGCCTTTCATTGAAGGAATAGAAGGTCAATTCGGCAATTGGAACTGCTTGGACTCTTGGTAC
TGCTGGGGTTGTGCCTGGCCTCAAGGCGATGTGAATAAAACTACCGCGGACGATCGTTACTATATTTCGCAGATG
GGTTCATCAACCAAATATGCGGCTACGATCAGTCCTTGGATATTTACCCATTATGACTACAAGAACTTCTATCAA
CGTGGGGATGACTGGCTTATCGTAAGCCGTTGGGAGCAACTCATTGAAATGAGAGATCAGCTTCCCATGGTTGAG
ATGGTTACTTGGAATGATTTCGGAGAATCCAGTTATTTTGGGCATGTCAAAGGAGTGCAGCCTTCGGGAACGACA
TGGGCAGACGGTTATTCACACCTTCCCTTTTTTGAGCTTTCCAAGTATTATATTACGGCATTTAAAACAGGTCAT
TATCCTGCCATCAATCAGGACGTCATCTATTTCTGGGCTCGCCCTCATCCTGCAGAAGCAGCAGCGTCCGTCGAT
GCGCTCGCCAGGCCTCAAGGTTACAACTTTGCCGAAGACTCTCTCTGGGCCCTTGCATTCGCCACCCAGTCAGGC
CAAGTCACATTGACTTGCGGGACTTCGACACAACAATTTACGGTTAATCCTGGCATCAATAAGCTTAAATTACCG
TTATCCCCTGGACAAATAACTGTTTCGATGAGTAGAGATGGGAAAAGGATAATCAACAAATCACCGTCTGATTTT
ACTTATAATGCATCTCCGGATCTATACAATTACAATGTCTACGTCGGAAGTGCAAAGGCGGGACCTGGACAATCG
GTCCCGGAGACCATGTCAACAGGAAGCGCGACGCACCTTTCGTCTACGTACTCGACAAGTGCAACGCAGACTCCA
AGTTCGATGATAACAAGCGCAGGCCAGGATTCAACCACTCCTACTCTCTCAAGGACTACAAGCTCCTATGTTTCG
ATCTCGACTCAGGCACCTACACCTACCGGAGGGTCCTGGCAGTATGTCGGTTGTGTAGCAGAAGGGACGACTGGC
CCCCGCCGGGCACTCTCCGGCGCATCCTATTCGAAGTCTGATATGACACCCGAGAAATGCCAGACTCTTTGCGCT
GGGTATACGTTCGCTGGGGTGGAATATGGGCAAGAATGCTACTGTGGCAACACACTTACGAACAATGGTGCAAGT
GGGAATGTCATCTCCCCGAACGAGTGTTCCTTGCCCTGCATGGGTGACCCGTCGAAGAGCTGTGGCGGCGTTTGG
ACATTAAATGTCTACACTACTCTCTCAAATATCCCGTCAAATACCCATCCAAGCACTCACAACGGTTGGGAGAGC
CTTGGGTGTTATATTGATTCAACGGATAGGTTGTTGAAGGGATTCTTCACAATTAAACCAGGTATGACAGCGGCG
ACGTGTGTAGCTGAATGTTCGGACCATGGATTTATCTATGCCGCGACTGAGTATGGCGTTGAGTGTCATTGCGGC
AACCAGATCGAATCTTATGGTTCTGGGGTTAGTGTGGATGGAAGTCAGTGCAATATGGCTTGCGACGGTGACCCA
TCTACGAAATGTGGTGGAAGTTGGCGCGCCAATGTTTATAGAATCTCAGCTAAAAGCTCCAGGAGTTTGGTGTCC
CAAAAACATCATGTCTCGCGGAAGAAAAAGCATCATTAA
Transcript >AgabiH97|035720
ATGAGATCCGTTCCGTTCTTTATCTCTTTTCTGACAATTCTGGGGCTCACAGAGGCTGGCCTTTTGCCCCACCTC
TTTCTGAAGCAAGCTCAATCGCGTGGATATGCGGATTTCCTACCAAGACGATCAAATTCAACCTTACAGCCTCGC
CGCAGCGATCCCAAATATGTTTTCATGCACCACATTGTTGGAAGTACATATGACTACACCATCGATGATTGGAAG
AGCGATATTCAAGAGATAGGTTCGGGAGGGGTCGACGCTATCGCGCTCAACTTTGGTTCTGATTATTGGGAGAAT
GAACAGCTCCATAACGCTTATGATGCTGGTTCTGGCTCTGGTGTCAAGCTTTTCTTATCCTTCGACTTCAGTGTG
TTTCCATGCGACGTAAACTCTGTTGTCAACCTTGTCAATCAATTTGCCCAACATGAAAGCCAGTTTAAAGTTGAC
GGGCGCCCGCTCATATCTTCCTTTTTGGGTGCTTGCCTAGGCAGTCAGGGCTGGCAGGAGATTAAGGATAGAACA
GGCGGATACTTAATGCCTTTCATTGAAGGAATAGAAGGTCAATTCGGCAATTGGAACTGCTTGGACTCTTGGTAC
TGCTGGGGTTGTGCCTGGCCTCAAGGCGATGTGAATAAAACTACCGCGGACGATCGTTACTATATTTCGCAGATG
GGTTCATCAACCAAATATGCGGCTACGATCAGTCCTTGGATATTTACCCATTATGACTACAAGAACTTCTATCAA
CGTGGGGATGACTGGCTTATCGTAAGCCGTTGGGAGCAACTCATTGAAATGAGAGATCAGCTTCCCATGGTTGAG
ATGGTTACTTGGAATGATTTCGGAGAATCCAGTTATTTTGGGCATGTCAAAGGAGTGCAGCCTTCGGGAACGACA
TGGGCAGACGGTTATTCACACCTTCCCTTTTTTGAGCTTTCCAAGTATTATATTACGGCATTTAAAACAGGTCAT
TATCCTGCCATCAATCAGGACGTCATCTATTTCTGGGCTCGCCCTCATCCTGCAGAAGCAGCAGCGTCCGTCGAT
GCGCTCGCCAGGCCTCAAGGTTACAACTTTGCCGAAGACTCTCTCTGGGCCCTTGCATTCGCCACCCAGTCAGGC
CAAGTCACATTGACTTGCGGGACTTCGACACAACAATTTACGGTTAATCCTGGCATCAATAAGCTTAAATTACCG
TTATCCCCTGGACAAATAACTGTTTCGATGAGTAGAGATGGGAAAAGGATAATCAACAAATCACCGTCTGATTTT
ACTTATAATGCATCTCCGGATCTATACAATTACAATGTCTACGTCGGAAGTGCAAAGGCGGGACCTGGACAATCG
GTCCCGGAGACCATGTCAACAGGAAGCGCGACGCACCTTTCGTCTACGTACTCGACAAGTGCAACGCAGACTCCA
AGTTCGATGATAACAAGCGCAGGCCAGGATTCAACCACTCCTACTCTCTCAAGGACTACAAGCTCCTATGTTTCG
ATCTCGACTCAGGCACCTACACCTACCGGAGGGTCCTGGCAGTATGTCGGTTGTGTAGCAGAAGGGACGACTGGC
CCCCGCCGGGCACTCTCCGGCGCATCCTATTCGAAGTCTGATATGACACCCGAGAAATGCCAGACTCTTTGCGCT
GGGTATACGTTCGCTGGGGTGGAATATGGGCAAGAATGCTACTGTGGCAACACACTTACGAACAATGGTGCAAGT
GGGAATGTCATCTCCCCGAACGAGTGTTCCTTGCCCTGCATGGGTGACCCGTCGAAGAGCTGTGGCGGCGTTTGG
ACATTAAATGTCTACACTACTCTCTCAAATATCCCGTCAAATACCCATCCAAGCACTCACAACGGTTGGGAGAGC
CTTGGGTGTTATATTGATTCAACGGATAGGTTGTTGAAGGGATTCTTCACAATTAAACCAGGTATGACAGCGGCG
ACGTGTGTAGCTGAATGTTCGGACCATGGATTTATCTATGCCGCGACTGAGTATGGCGTTGAGTGTCATTGCGGC
AACCAGATCGAATCTTATGGTTCTGGGGTTAGTGTGGATGGAAGTCAGTGCAATATGGCTTGCGACGGTGACCCA
TCTACGAAATGTGGTGGAAGTTGGCGCGCCAATGTTTATAGAATCTCAGCTAAAAGCTCCAGGAGTTTGGTGTCC
CAAAAACATCATGTCTCGCGGAAGAAAAAGCATCATTAA
Gene >AgabiH97|035720
ATGAGATCCGTTCCGTTCTTTATCTCTTTTCTGACAATTCTGGGGCTCACAGAGGCTGGCCTTTTGCCCCACCTC
TTTCTGAAGCAAGCTCAATCGCGTGGATATGCGGATTTCCTACCAAGACGATCAAATTCAACCTTACAGCCTCGC
CGCAGCGATCCCAAATATGTTTTCATGCACCACGTATGTTTAAGATGATACCTCTCTTTGCAACTCGCTCTCATA
ACTTCTTGTAGATTGTTGGAAGTACGTCGTCGTCGTTTATCTATGTCCGAATCTGAACGACGTCATCTTTCCTTC
CTTATCAGACACGTGAGTTCCGATTCGCAACCCTAGAAGGTTCCATCCAACATTATTTGAATCACCTTCAAAGAT
ATGACTACACCATCGATGATTGGAAGAGCGATATTCAAGAGATAGGTTCGGGAGGGGTGTAAGTCTTGTCGGGAA
ACTTGCGAATTGTGTTTTAACATTTTTATTACAAGCGACGCTATCGCGCTCAACTTTGGTTCTGATTATTGGGAG
AATGAACAGCTCCATAACGCTTATGATGCTGGTTCTGGCTCTGGTGTCAAGCTTTTCTTATCCTTCGACTTCAGT
GTGTTTCCATGCGACGTAAACTCTGTTGTCAACCTTGTCAATCAATTTGCCCAACATGAAAGCCAGTTTAAAGTT
GACGGGCGCCCGCTCATATCTTCCTTTTTGGGTGCTTGCCTAGGCAGTCAGGGCTGGCAGGAGATTAAGGATAGA
ACAGGCGGATACTTAATGCCTTTCATTGAAGGAATAGAAGGTCAATTCGGCAATTGGAACTGCTTGGACTCTTGG
TACTGGTGAGCGCGCTGAACTTTTTTTAGACAACACTTTTAATAACGAGGAAACAGCTGGGGTTGTGCCTGGCCT
CAAGGCGATGTGAATAAAACTGTAAGTCAAGTAATTTTAGGATGCCTTGTTACCATTGATCACGAGTCTCAGACC
GCGGACGATCGTTACTGTAAGTGTTGACCCGGAGTGTGGGATTAATTTTATCAATATCTGTTTAGATATTTCGCA
GATGGGTTCATCAACCAAATATGCGGCTACGATCAGTCCTTGGATATTGTACGTACCCACCCTCAGGGCTCGCTA
TCGCAGATACTCACCTGATATCAGTACCCATTATGACTACAAGAACTTCTATCAACGTGGGGATGACTGGCTTAT
CGTAAGCCGTTGGGAGCAACTCATTGAAATGAGAGATCAGCTTCCCATGGTTGAGATGGTTACTTGGTGAGCAAA
TGGTCCCGCTCTGAATTTATTTCTAGAAATTCATCTTACCCGGCACAGGAATGATTTCGGAGAATCCAGTTAGTA
AGTTGTGTGCCTTTTGAATGCACTCTCGCTCAATGTTCATGAATTTCAGTTTTGGGCATGTCAAAGGAGTGCAGC
CTTCGGGAACGACATGGGCAGACGGTTATTCACACCTTCCCTTTTTTGAGCTTTCCAAGTATTATATTACGGCAT
TTAAAACAGGTCATTATCCTGCCATCAATGTATGTTTCTATTTTTCTACCGGAGGTAAACCTACTTTGGAAGAGG
GCTCATGATAATTATATAGCAGGACGTCATCTATTTCTGGGCTCGCCCTCATCCTGCAGAAGCAGCAGCGTCCGT
CGATGCGCTCGCCAGGCCTCAAGGTTACAACTTTGCCGAAGTTCGTATACGATTCTTTTTGAATCTGCATTAAAT
GTCTCATTGCCAAGTCAGGACTCTCTCTGGGCCCTTGCATTCGCCACCCAGTCAGGCCAAGTCACATTGACTTGC
GGGACTTCGACACAACAATTTACGGTTAATCCTGGCATCAATAAGCTTAAATTACCGTTATCCCCTGGACAAATA
ACTGTTTCGATGAGTAGAGATGGGAAAAGGATAATCAACAAATCACCGTCTGATTTTACTTATAATGCATCTCCG
GATCTATGTACGTGTCGTGTTTCTGGGAGGGAGGTCGAAGCTGATATGGAATCATACGACAGACAATTACAATGT
CTACGTCGGAAGTGCAAGTAAGTTTTTCATTTTTACCATGAACGTGTCCAACTCTAAACGCTTTTATCAGAGGCG
GGACCTGGACAATCGGTCCCGGAGACCATGTCAACAGGAAGCGCGACGCACCTTTCGTCTACGTACTCGACAAGT
GCAACGCAGACTCCAAGTTCGATGATAACAAGCGCAGGCCAGGATTCAACCACTCCTACTCTCTCAAGGACTACA
AGCTCCTATGTTTCGATCTCGACTCAGGCACCTACACCTACCGGAGGGTCCTGGCAGTATGTCGGTTGTGTAGCA
GAAGGGACGACTGGCCCCCGCCGGGCACTCTCCGGCGCATCCTATTCGAAGTCTGATATGACACCCGAGAAATGC
CAGACTCTTTGCGCTGGGTATACGTTCGCTGGGGTGGAATATGGGTATGTACTTCGAACCTCATACGCTTTCCAT
ATATCTAACCGTGGTACCTAGGCAAGAATGTATGTCCTGAGTTTAGTTAGTTTATTCACTGATATATCTGGGATT
GACAGGCTACTGTGGCAACACACTTACGAACAATGGTGCAAGTGGGAATGTCATCTCCCCGAACGAGTGTTCCTT
GCCCTGCATGGGTGACCCGTCGAAGAGCTGTGGCGGCGTTTGGACATTAAATGTCTACACTACTCTCTCAAATAT
CCCGTCAAATACCCATCCAAGCACTCACAACGTAAGCGACCCTTCTTTTGCTTCGTTTTCCTGGCTCTTAATGAA
ATATAAAAGGGTTGGGAGAGCCTTGGGTGTTATATTGATTCAACGGATAGGTTGTTGAAGGGATTCTTCACAATT
AAACCAGGTATGACAGCGGCGACGTGTGTAGCTGAATGTTCGGACCATGGATTTATCTATGCCGCGACTGAGTAT
GGCGTTGAGTGTCATTGCGGCAACCAGATCGAATCTTATGGTTCTGGGGTTAGTGTGGATGGAAGTCAGTGCAAT
ATGGCTTGCGACGGTAAAATATCCTTCACCTTCGGCTTGTCGGATGTTGTTTTGCTGATAGATATTGATGTAAAG
GTGACCCATCTACGAAATGTGGTGGAAGTTGGCGCGCCAATGTTTATAGAATCTCAGCTAAAAGCTCCAGGAGTT
TGGTGTCCCAAAAACATCATGTCTCGCGGAAGAAAAAGCATCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail