Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|035360
Gene name
Locationscaffold_13:463777..466057
Strand+
Gene length (bp)2280
Transcript length (bp)2280
Coding sequence length (bp)2280
Protein length (aa) 760

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 6.4E-13 89 206
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.7E-12 514 586
PF00665 rve Integrase core domain 2.1E-08 600 700

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 403 745 5.0E-31
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 284 745 5.0E-28
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 284 745 5.0E-28
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 284 745 5.0E-28
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 284 745 6.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 403 745 5.0E-31
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 284 745 5.0E-28
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 284 745 5.0E-28
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 284 745 5.0E-28
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 284 745 6.0E-28
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 284 745 6.0E-28
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 284 745 7.0E-28
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 284 745 7.0E-28
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 284 745 7.0E-28
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 284 745 7.0E-28
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 284 745 7.0E-28
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 284 745 8.0E-28
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 284 745 8.0E-28
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 284 745 8.0E-28
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 284 745 8.0E-28
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 284 745 8.0E-28
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 284 745 1.0E-27
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 284 745 1.0E-27
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 284 745 1.0E-27
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 284 745 1.0E-27
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 284 745 1.0E-27
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 284 745 1.0E-27
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 284 745 1.0E-27
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 284 745 2.0E-27
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 284 745 2.0E-27
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 284 745 2.0E-27
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 284 745 3.0E-27
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 284 745 3.0E-27
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 284 745 4.0E-27
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 284 745 6.0E-27
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 454 745 7.0E-27
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 454 745 7.0E-27
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 454 745 8.0E-27
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 465 745 4.0E-26
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 465 745 1.0E-25
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 465 745 2.0E-25
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 388 745 2.0E-25
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 465 745 2.0E-25
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 465 745 2.0E-25
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 465 745 2.0E-25
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 465 745 2.0E-25
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 465 745 2.0E-25
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 465 745 2.0E-25
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 465 745 2.0E-25
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 465 745 2.0E-25
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 465 745 2.0E-25
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 567 745 7.0E-16
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 534 748 1.0E-13
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 534 748 2.0E-13
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 534 745 7.0E-12
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 521 747 1.0E-08
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 521 747 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|035360
MSNTTPPIFPETDKFDGTNWVAWNGLIGIAADLRGISGYLEGTIPKPPDNPPILLTSPASPQGQTTTTSPTTPPP
DTPWDSINPSLAEWKTRNAWTKGLLVYNTKDPIGLGVNLSGTAANAWKSYKDQYAKVSEMAILNADRDLREITYS
DGHDFLEHIARLRTKWATATALGAPIDDKTFRTIVLSSLPRSWDPIVSTLYNTTTSREAIAVLATHWARISKDRV
VNPQNATMALQFNTYHNNHNRNTPKNQHLVCTNPNCGRRGHLIADCYWQGGGKAGQFPAWFGKKGGTRGSTPHAN
GGNTNTSANSASTSDTTAQSSEPRVFALSMVTSEMPQVLSINPITPIHIPDHDKTSRMLKIATSGITPRGELEGG
AQMSYTLHNVSTLSSITQTSNTTDLLTLLDSGATDHCFAEREDFITYKSFQTPRDGHPANKSAVFNLIGTGTVEI
LTHRDNATTKIQISEALHSPDLRHNLISVSKLTSKGLNVVFDDNTATVYNSQGIAVVTARKIQGLYIVETISRTS
SIHVMQTKRKSVPFSTWHRRLAHAGEGTIKEMLRLDLVDGLNVEGQHEIGGTCEDCIFGKHTAHPHSDKGKVEEE
VLERIHVDIWGPASVQSVGGSKYLMVIVDGASSFRTIFPLPEKSAAVTLNCLKTFQVQSELQTGKKLKRIRLDMG
REWYNNLWETYARERGIILEYTTPYAHQQNGVVERSMRTLVDLGRSMLAESGLPQRYWADAFVTAGYIRNCYDCG
TNPSILNLI*
Coding >AgabiH97|035360
ATGTCGAACACTACACCCCCTATATTCCCAGAAACTGACAAATTCGACGGTACAAACTGGGTAGCTTGGAATGGC
CTGATCGGTATAGCCGCCGATCTCAGAGGCATTTCCGGATACCTTGAGGGCACGATCCCTAAACCCCCTGACAAT
CCACCTATCCTTCTCACGTCACCTGCTTCACCTCAAGGACAGACTACTACAACGTCTCCAACAACACCACCACCT
GACACTCCATGGGACTCCATAAACCCTTCCCTTGCTGAATGGAAAACCCGTAACGCTTGGACCAAAGGATTGCTT
GTATACAATACGAAGGACCCCATTGGTTTAGGTGTCAACTTATCTGGCACTGCCGCCAATGCGTGGAAATCCTAC
AAGGACCAATATGCGAAAGTATCAGAAATGGCGATCTTGAATGCTGATCGAGACCTACGAGAAATCACTTACTCT
GATGGTCATGATTTCCTCGAGCATATTGCTCGACTACGCACAAAATGGGCTACAGCTACGGCTCTCGGAGCACCA
ATCGATGACAAGACGTTTCGAACTATTGTCCTCTCCTCATTACCACGATCTTGGGATCCCATAGTGTCTACCCTC
TACAACACGACAACATCCCGTGAAGCCATCGCTGTACTCGCCACCCACTGGGCTCGTATTAGCAAGGATCGAGTC
GTGAATCCACAAAACGCAACTATGGCGCTCCAATTCAACACATATCACAACAATCATAACAGAAACACACCAAAG
AATCAACATCTTGTCTGTACCAATCCTAACTGTGGTCGACGAGGACACTTGATTGCTGATTGTTATTGGCAAGGG
GGAGGCAAAGCTGGCCAATTCCCAGCGTGGTTCGGAAAGAAGGGAGGCACTAGAGGAAGCACACCACACGCAAAT
GGAGGAAACACTAATACTTCTGCCAACTCAGCGTCTACTTCGGACACAACAGCCCAAAGTTCCGAACCTCGTGTT
TTCGCACTCTCCATGGTCACGTCGGAGATGCCTCAGGTACTGAGCATCAACCCTATAACCCCTATCCATATTCCT
GACCACGACAAAACCTCCAGGATGCTGAAAATAGCCACTAGCGGCATAACACCGAGAGGGGAGCTGGAGGGTGGT
GCTCAAATGTCCTACACGTTACATAATGTCTCAACGTTGTCATCTATAACGCAGACGAGCAATACGACAGACTTG
CTTACCCTACTTGATTCCGGTGCTACCGATCACTGCTTTGCGGAGCGTGAAGATTTCATAACATATAAATCCTTC
CAAACTCCACGAGACGGCCATCCTGCAAATAAATCTGCAGTTTTCAACCTTATTGGTACTGGAACTGTCGAAATT
CTTACCCATAGAGACAATGCTACAACCAAGATCCAAATCTCTGAGGCTCTACACTCGCCTGATCTCCGCCATAAC
TTGATCTCGGTGTCGAAATTGACTTCTAAAGGACTAAACGTCGTCTTCGATGATAATACGGCTACTGTGTATAAC
AGTCAGGGCATAGCTGTGGTTACCGCCCGTAAGATTCAAGGATTATATATCGTCGAAACCATATCACGCACCTCG
TCGATCCATGTTATGCAAACAAAGAGGAAATCTGTCCCATTCAGTACCTGGCATCGACGTTTGGCCCATGCAGGA
GAAGGAACAATTAAAGAGATGTTACGTTTGGATTTAGTTGATGGCCTAAACGTTGAAGGGCAACATGAGATAGGA
GGCACATGCGAGGATTGTATCTTTGGGAAACATACCGCGCATCCACACTCGGATAAAGGGAAAGTCGAGGAGGAG
GTCCTGGAACGCATCCATGTTGACATATGGGGGCCGGCTTCAGTCCAGTCGGTTGGAGGATCCAAATATCTTATG
GTCATCGTAGATGGTGCTTCATCTTTCCGCACAATATTCCCTCTCCCTGAGAAATCGGCCGCCGTTACTCTCAAC
TGCCTCAAAACTTTTCAAGTGCAGTCGGAATTGCAAACGGGCAAAAAGCTGAAACGGATCCGTTTAGACATGGGA
CGAGAATGGTATAACAATTTATGGGAGACGTATGCGAGGGAAAGAGGAATTATCTTGGAGTATACAACTCCATAC
GCACACCAGCAAAACGGCGTTGTTGAACGATCGATGAGAACCTTGGTTGATCTCGGAAGGTCAATGCTAGCTGAG
TCAGGTCTCCCACAGCGCTATTGGGCAGATGCATTCGTAACAGCAGGTTACATTCGGAACTGTTATGATTGTGGA
ACAAATCCGAGTATTCTAAATCTTATCTGA
Transcript >AgabiH97|035360
ATGTCGAACACTACACCCCCTATATTCCCAGAAACTGACAAATTCGACGGTACAAACTGGGTAGCTTGGAATGGC
CTGATCGGTATAGCCGCCGATCTCAGAGGCATTTCCGGATACCTTGAGGGCACGATCCCTAAACCCCCTGACAAT
CCACCTATCCTTCTCACGTCACCTGCTTCACCTCAAGGACAGACTACTACAACGTCTCCAACAACACCACCACCT
GACACTCCATGGGACTCCATAAACCCTTCCCTTGCTGAATGGAAAACCCGTAACGCTTGGACCAAAGGATTGCTT
GTATACAATACGAAGGACCCCATTGGTTTAGGTGTCAACTTATCTGGCACTGCCGCCAATGCGTGGAAATCCTAC
AAGGACCAATATGCGAAAGTATCAGAAATGGCGATCTTGAATGCTGATCGAGACCTACGAGAAATCACTTACTCT
GATGGTCATGATTTCCTCGAGCATATTGCTCGACTACGCACAAAATGGGCTACAGCTACGGCTCTCGGAGCACCA
ATCGATGACAAGACGTTTCGAACTATTGTCCTCTCCTCATTACCACGATCTTGGGATCCCATAGTGTCTACCCTC
TACAACACGACAACATCCCGTGAAGCCATCGCTGTACTCGCCACCCACTGGGCTCGTATTAGCAAGGATCGAGTC
GTGAATCCACAAAACGCAACTATGGCGCTCCAATTCAACACATATCACAACAATCATAACAGAAACACACCAAAG
AATCAACATCTTGTCTGTACCAATCCTAACTGTGGTCGACGAGGACACTTGATTGCTGATTGTTATTGGCAAGGG
GGAGGCAAAGCTGGCCAATTCCCAGCGTGGTTCGGAAAGAAGGGAGGCACTAGAGGAAGCACACCACACGCAAAT
GGAGGAAACACTAATACTTCTGCCAACTCAGCGTCTACTTCGGACACAACAGCCCAAAGTTCCGAACCTCGTGTT
TTCGCACTCTCCATGGTCACGTCGGAGATGCCTCAGGTACTGAGCATCAACCCTATAACCCCTATCCATATTCCT
GACCACGACAAAACCTCCAGGATGCTGAAAATAGCCACTAGCGGCATAACACCGAGAGGGGAGCTGGAGGGTGGT
GCTCAAATGTCCTACACGTTACATAATGTCTCAACGTTGTCATCTATAACGCAGACGAGCAATACGACAGACTTG
CTTACCCTACTTGATTCCGGTGCTACCGATCACTGCTTTGCGGAGCGTGAAGATTTCATAACATATAAATCCTTC
CAAACTCCACGAGACGGCCATCCTGCAAATAAATCTGCAGTTTTCAACCTTATTGGTACTGGAACTGTCGAAATT
CTTACCCATAGAGACAATGCTACAACCAAGATCCAAATCTCTGAGGCTCTACACTCGCCTGATCTCCGCCATAAC
TTGATCTCGGTGTCGAAATTGACTTCTAAAGGACTAAACGTCGTCTTCGATGATAATACGGCTACTGTGTATAAC
AGTCAGGGCATAGCTGTGGTTACCGCCCGTAAGATTCAAGGATTATATATCGTCGAAACCATATCACGCACCTCG
TCGATCCATGTTATGCAAACAAAGAGGAAATCTGTCCCATTCAGTACCTGGCATCGACGTTTGGCCCATGCAGGA
GAAGGAACAATTAAAGAGATGTTACGTTTGGATTTAGTTGATGGCCTAAACGTTGAAGGGCAACATGAGATAGGA
GGCACATGCGAGGATTGTATCTTTGGGAAACATACCGCGCATCCACACTCGGATAAAGGGAAAGTCGAGGAGGAG
GTCCTGGAACGCATCCATGTTGACATATGGGGGCCGGCTTCAGTCCAGTCGGTTGGAGGATCCAAATATCTTATG
GTCATCGTAGATGGTGCTTCATCTTTCCGCACAATATTCCCTCTCCCTGAGAAATCGGCCGCCGTTACTCTCAAC
TGCCTCAAAACTTTTCAAGTGCAGTCGGAATTGCAAACGGGCAAAAAGCTGAAACGGATCCGTTTAGACATGGGA
CGAGAATGGTATAACAATTTATGGGAGACGTATGCGAGGGAAAGAGGAATTATCTTGGAGTATACAACTCCATAC
GCACACCAGCAAAACGGCGTTGTTGAACGATCGATGAGAACCTTGGTTGATCTCGGAAGGTCAATGCTAGCTGAG
TCAGGTCTCCCACAGCGCTATTGGGCAGATGCATTCGTAACAGCAGGTTACATTCGGAACTGTTATGATTGTGGA
ACAAATCCGAGTATTCTAAATCTTATCTGA
Gene >AgabiH97|035360
ATGTCGAACACTACACCCCCTATATTCCCAGAAACTGACAAATTCGACGGTACAAACTGGGTAGCTTGGAATGGC
CTGATCGGTATAGCCGCCGATCTCAGAGGCATTTCCGGATACCTTGAGGGCACGATCCCTAAACCCCCTGACAAT
CCACCTATCCTTCTCACGTCACCTGCTTCACCTCAAGGACAGACTACTACAACGTCTCCAACAACACCACCACCT
GACACTCCATGGGACTCCATAAACCCTTCCCTTGCTGAATGGAAAACCCGTAACGCTTGGACCAAAGGATTGCTT
GTATACAATACGAAGGACCCCATTGGTTTAGGTGTCAACTTATCTGGCACTGCCGCCAATGCGTGGAAATCCTAC
AAGGACCAATATGCGAAAGTATCAGAAATGGCGATCTTGAATGCTGATCGAGACCTACGAGAAATCACTTACTCT
GATGGTCATGATTTCCTCGAGCATATTGCTCGACTACGCACAAAATGGGCTACAGCTACGGCTCTCGGAGCACCA
ATCGATGACAAGACGTTTCGAACTATTGTCCTCTCCTCATTACCACGATCTTGGGATCCCATAGTGTCTACCCTC
TACAACACGACAACATCCCGTGAAGCCATCGCTGTACTCGCCACCCACTGGGCTCGTATTAGCAAGGATCGAGTC
GTGAATCCACAAAACGCAACTATGGCGCTCCAATTCAACACATATCACAACAATCATAACAGAAACACACCAAAG
AATCAACATCTTGTCTGTACCAATCCTAACTGTGGTCGACGAGGACACTTGATTGCTGATTGTTATTGGCAAGGG
GGAGGCAAAGCTGGCCAATTCCCAGCGTGGTTCGGAAAGAAGGGAGGCACTAGAGGAAGCACACCACACGCAAAT
GGAGGAAACACTAATACTTCTGCCAACTCAGCGTCTACTTCGGACACAACAGCCCAAAGTTCCGAACCTCGTGTT
TTCGCACTCTCCATGGTCACGTCGGAGATGCCTCAGGTACTGAGCATCAACCCTATAACCCCTATCCATATTCCT
GACCACGACAAAACCTCCAGGATGCTGAAAATAGCCACTAGCGGCATAACACCGAGAGGGGAGCTGGAGGGTGGT
GCTCAAATGTCCTACACGTTACATAATGTCTCAACGTTGTCATCTATAACGCAGACGAGCAATACGACAGACTTG
CTTACCCTACTTGATTCCGGTGCTACCGATCACTGCTTTGCGGAGCGTGAAGATTTCATAACATATAAATCCTTC
CAAACTCCACGAGACGGCCATCCTGCAAATAAATCTGCAGTTTTCAACCTTATTGGTACTGGAACTGTCGAAATT
CTTACCCATAGAGACAATGCTACAACCAAGATCCAAATCTCTGAGGCTCTACACTCGCCTGATCTCCGCCATAAC
TTGATCTCGGTGTCGAAATTGACTTCTAAAGGACTAAACGTCGTCTTCGATGATAATACGGCTACTGTGTATAAC
AGTCAGGGCATAGCTGTGGTTACCGCCCGTAAGATTCAAGGATTATATATCGTCGAAACCATATCACGCACCTCG
TCGATCCATGTTATGCAAACAAAGAGGAAATCTGTCCCATTCAGTACCTGGCATCGACGTTTGGCCCATGCAGGA
GAAGGAACAATTAAAGAGATGTTACGTTTGGATTTAGTTGATGGCCTAAACGTTGAAGGGCAACATGAGATAGGA
GGCACATGCGAGGATTGTATCTTTGGGAAACATACCGCGCATCCACACTCGGATAAAGGGAAAGTCGAGGAGGAG
GTCCTGGAACGCATCCATGTTGACATATGGGGGCCGGCTTCAGTCCAGTCGGTTGGAGGATCCAAATATCTTATG
GTCATCGTAGATGGTGCTTCATCTTTCCGCACAATATTCCCTCTCCCTGAGAAATCGGCCGCCGTTACTCTCAAC
TGCCTCAAAACTTTTCAAGTGCAGTCGGAATTGCAAACGGGCAAAAAGCTGAAACGGATCCGTTTAGACATGGGA
CGAGAATGGTATAACAATTTATGGGAGACGTATGCGAGGGAAAGAGGAATTATCTTGGAGTATACAACTCCATAC
GCACACCAGCAAAACGGCGTTGTTGAACGATCGATGAGAACCTTGGTTGATCTCGGAAGGTCAATGCTAGCTGAG
TCAGGTCTCCCACAGCGCTATTGGGCAGATGCATTCGTAACAGCAGGTTACATTCGGAACTGTTATGATTGTGGA
ACAAATCCGAGTATTCTAAATCTTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail