Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034970
Gene name
Locationscaffold_13:359176..360451
Strand-
Gene length (bp)1275
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.7E-28 40 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 17 237 7.0E-31
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 33 237 8.0E-29
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 44 234 1.0E-24
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 44 236 1.0E-24
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 38 223 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 17 237 7.0E-31
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 33 237 8.0E-29
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 44 234 1.0E-24
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 44 236 1.0E-24
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 38 223 1.0E-22
sp|Q06702|CDA1_YEAST Chitin deacetylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA1 PE=1 SV=1 37 240 1.0E-22
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 37 240 6.0E-18
sp|P0CP76|CDA_CRYNJ Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MP 84 PE=2 SV=1 39 244 6.0E-16
sp|P0CP77|CDA_CRYNB Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MP 84 PE=3 SV=1 39 244 8.0E-16
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 22 238 1.0E-15
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 48 240 2.0E-15
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 37 242 2.0E-15
sp|P82476|CDA_CRYNH Chitin deacetylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01239 PE=1 SV=3 39 244 2.0E-14
sp|P50865|PDAB_BACSU Probable polysaccharide deacetylase PdaB OS=Bacillus subtilis (strain 168) GN=pdaB PE=3 SV=2 36 235 6.0E-14
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 7 235 3.0E-13
sp|Q52845|NODB_RHILO Chitooligosaccharide deacetylase OS=Rhizobium loti (strain MAFF303099) GN=nodB PE=3 SV=2 48 233 9.0E-13
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 48 233 1.0E-12
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 33 233 2.0E-12
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 41 231 3.0E-12
sp|P50354|NODB_RHIGA Chitooligosaccharide deacetylase OS=Rhizobium galegae GN=nodB PE=3 SV=1 43 174 6.0E-12
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 47 174 7.0E-12
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 48 233 3.0E-11
sp|P50850|YLXY_BACSU Uncharacterized protein YlxY OS=Bacillus subtilis (strain 168) GN=ylxY PE=3 SV=2 64 237 1.0E-10
sp|O07596|YHEN_BACSU Putative polysaccharide deacetylase YheN OS=Bacillus subtilis (strain 168) GN=yheN PE=3 SV=1 43 235 2.0E-09
sp|Q07740|NODB_AZOC5 Chitooligosaccharide deacetylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodB PE=3 SV=2 31 231 9.0E-09
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 48 174 8.0E-08
sp|P04676|NODB_RHILT Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. trifolii GN=nodB PE=3 SV=1 41 233 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 16.10 7.44 24.76
Initials Initials knots 11.38 5.07 17.69
Pileal_Stipeal_center Stage I stipe center 13.46 6.18 20.75
Pileal_Stipeal_shell Stage I stipe shell 9.50 4.09 14.91
DIF_stipe_center Stage II stipe center 15.82 7.53 24.10
DIF_stipe_shell Stage II stipe shell 13.37 6.16 20.58
DIF_stipe_skin Stage II stipe skin 10.90 4.90 16.89
DIF_cap_skin Stage II cap skin 7.62 3.22 12.01
DIF_cap_tissue Stage II cap tissue 8.89 3.85 13.93
DIF_gill_tissue Stage II gill tissue 10.58 4.62 16.55
YFB_stipe_center Young fruiting body stipe center 12.30 5.64 18.95
YFB_stipe_shell Young fruiting body stipe shell 11.54 5.24 17.84
YFB_stipe_skin Young fruiting body stipe skin 10.40 4.63 16.17
YFB_cap_skin Young fruiting body cap skin 6.33 2.55 10.11
YFB_cap_tissue Young fruiting body cap tissue 6.82 2.72 10.92
YFB_gill_tissue Young fruiting body gill tissue 7.24 3.02 11.46
YFB_veil Young fruiting body veil 7.06 2.80 11.32

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.343101 no
Casing YFB_stipe_center 0.600155 no
Casing YFB_stipe_shell 0.481021 no
Casing YFB_stipe_skin 0.298054 no
Casing YFB_cap_skin 0.011968 yes
Casing YFB_cap_tissue 0.018066 yes
Casing YFB_gill_tissue 0.032038 yes
Casing YFB_veil 0.029890 yes
Casing Initials 0.453226 no
Casing Pileal_Stipeal_center 0.761840 no
Casing Pileal_Stipeal_shell 0.197111 no
Casing DIF_stipe_center 0.980893 no
Casing DIF_stipe_shell 0.749074 no
Casing DIF_stipe_skin 0.373742 no
Casing DIF_cap_skin 0.045273 yes
Casing DIF_cap_tissue 0.136458 no
DIF_gill_tissue YFB_stipe_center 0.813953 no
DIF_gill_tissue YFB_stipe_shell 0.899738 no
DIF_gill_tissue YFB_stipe_skin 0.980167 no
DIF_gill_tissue YFB_cap_skin 0.243840 no
DIF_gill_tissue YFB_cap_tissue 0.332804 no
DIF_gill_tissue YFB_gill_tissue 0.425463 no
DIF_gill_tissue YFB_veil 0.396739 no
YFB_stipe_center YFB_stipe_shell 0.930692 no
YFB_stipe_center YFB_stipe_skin 0.775488 no
YFB_stipe_center YFB_cap_skin 0.099759 no
YFB_stipe_center YFB_cap_tissue 0.145389 no
YFB_stipe_center YFB_gill_tissue 0.199869 no
YFB_stipe_center YFB_veil 0.181080 no
YFB_stipe_shell YFB_stipe_skin 0.877923 no
YFB_stipe_shell YFB_cap_skin 0.145255 no
YFB_stipe_shell YFB_cap_tissue 0.207399 no
YFB_stipe_shell YFB_gill_tissue 0.278783 no
YFB_stipe_shell YFB_veil 0.254646 no
YFB_stipe_skin YFB_cap_skin 0.257482 no
YFB_stipe_skin YFB_cap_tissue 0.350412 no
YFB_stipe_skin YFB_gill_tissue 0.440546 no
YFB_stipe_skin YFB_veil 0.411711 no
YFB_cap_skin YFB_cap_tissue 0.925381 no
YFB_cap_skin YFB_gill_tissue 0.846349 no
YFB_cap_skin YFB_veil 0.881742 no
YFB_cap_tissue YFB_gill_tissue 0.938769 no
YFB_cap_tissue YFB_veil 0.966113 no
YFB_gill_tissue YFB_veil 0.975396 no
Initials DIF_gill_tissue 0.919450 no
Initials YFB_stipe_center 0.912124 no
Initials YFB_stipe_shell 0.985066 no
Initials YFB_stipe_skin 0.894295 no
Initials YFB_cap_skin 0.154660 no
Initials YFB_cap_tissue 0.225375 no
Initials YFB_gill_tissue 0.299456 no
Initials YFB_veil 0.276817 no
Initials Pileal_Stipeal_center 0.776875 no
Initials Pileal_Stipeal_shell 0.760869 no
Initials DIF_stipe_center 0.471702 no
Initials DIF_stipe_shell 0.785682 no
Initials DIF_stipe_skin 0.952375 no
Initials DIF_cap_skin 0.375672 no
Initials DIF_cap_tissue 0.643140 no
Pileal_Stipeal_center DIF_gill_tissue 0.660009 no
Pileal_Stipeal_center YFB_stipe_center 0.896926 no
Pileal_Stipeal_center YFB_stipe_shell 0.806968 no
Pileal_Stipeal_center YFB_stipe_skin 0.615400 no
Pileal_Stipeal_center YFB_cap_skin 0.057550 no
Pileal_Stipeal_center YFB_cap_tissue 0.080353 no
Pileal_Stipeal_center YFB_gill_tissue 0.112874 no
Pileal_Stipeal_center YFB_veil 0.098442 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.465106 no
Pileal_Stipeal_center DIF_stipe_center 0.786154 no
Pileal_Stipeal_center DIF_stipe_shell 0.992760 no
Pileal_Stipeal_center DIF_stipe_skin 0.704406 no
Pileal_Stipeal_center DIF_cap_skin 0.155171 no
Pileal_Stipeal_center DIF_cap_tissue 0.355186 no
Pileal_Stipeal_shell DIF_gill_tissue 0.876712 no
Pileal_Stipeal_shell YFB_stipe_center 0.632672 no
Pileal_Stipeal_shell YFB_stipe_shell 0.743110 no
Pileal_Stipeal_shell YFB_stipe_skin 0.898413 no
Pileal_Stipeal_shell YFB_cap_skin 0.407377 no
Pileal_Stipeal_shell YFB_cap_tissue 0.516489 no
Pileal_Stipeal_shell YFB_gill_tissue 0.613280 no
Pileal_Stipeal_shell YFB_veil 0.579151 no
Pileal_Stipeal_shell DIF_stipe_center 0.210069 no
Pileal_Stipeal_shell DIF_stipe_shell 0.480754 no
Pileal_Stipeal_shell DIF_stipe_skin 0.833015 no
Pileal_Stipeal_shell DIF_cap_skin 0.705609 no
Pileal_Stipeal_shell DIF_cap_tissue 0.929298 no
DIF_stipe_center DIF_gill_tissue 0.361539 no
DIF_stipe_center YFB_stipe_center 0.621927 no
DIF_stipe_center YFB_stipe_shell 0.499611 no
DIF_stipe_center YFB_stipe_skin 0.316139 no
DIF_stipe_center YFB_cap_skin 0.012880 yes
DIF_stipe_center YFB_cap_tissue 0.022369 yes
DIF_stipe_center YFB_gill_tissue 0.034142 yes
DIF_stipe_center YFB_veil 0.032742 yes
DIF_stipe_center DIF_stipe_shell 0.769622 no
DIF_stipe_center DIF_stipe_skin 0.392751 no
DIF_stipe_center DIF_cap_skin 0.049257 yes
DIF_stipe_center DIF_cap_tissue 0.148373 no
DIF_stipe_shell DIF_gill_tissue 0.666062 no
DIF_stipe_shell YFB_stipe_center 0.905191 no
DIF_stipe_shell YFB_stipe_shell 0.812641 no
DIF_stipe_shell YFB_stipe_skin 0.622063 no
DIF_stipe_shell YFB_cap_skin 0.059906 no
DIF_stipe_shell YFB_cap_tissue 0.084528 no
DIF_stipe_shell YFB_gill_tissue 0.122169 no
DIF_stipe_shell YFB_veil 0.105864 no
DIF_stipe_shell DIF_stipe_skin 0.708521 no
DIF_stipe_shell DIF_cap_skin 0.166056 no
DIF_stipe_shell DIF_cap_tissue 0.363626 no
DIF_stipe_skin DIF_gill_tissue 0.969803 no
DIF_stipe_skin YFB_stipe_center 0.855387 no
DIF_stipe_skin YFB_stipe_shell 0.937818 no
DIF_stipe_skin YFB_stipe_skin 0.949707 no
DIF_stipe_skin YFB_cap_skin 0.201872 no
DIF_stipe_skin YFB_cap_tissue 0.279275 no
DIF_stipe_skin YFB_gill_tissue 0.364018 no
DIF_stipe_skin YFB_veil 0.336412 no
DIF_stipe_skin DIF_cap_skin 0.449367 no
DIF_stipe_skin DIF_cap_tissue 0.721219 no
DIF_cap_skin DIF_gill_tissue 0.512242 no
DIF_cap_skin YFB_stipe_center 0.267967 no
DIF_cap_skin YFB_stipe_shell 0.355101 no
DIF_cap_skin YFB_stipe_skin 0.529761 no
DIF_cap_skin YFB_cap_skin 0.776293 no
DIF_cap_skin YFB_cap_tissue 0.879681 no
DIF_cap_skin YFB_gill_tissue 0.948619 no
DIF_cap_skin YFB_veil 0.922054 no
DIF_cap_skin DIF_cap_tissue 0.813129 no
DIF_cap_tissue DIF_gill_tissue 0.779324 no
DIF_cap_tissue YFB_stipe_center 0.512296 no
DIF_cap_tissue YFB_stipe_shell 0.624854 no
DIF_cap_tissue YFB_stipe_skin 0.803131 no
DIF_cap_tissue YFB_cap_skin 0.513267 no
DIF_cap_tissue YFB_cap_tissue 0.629626 no
DIF_cap_tissue YFB_gill_tissue 0.732410 no
DIF_cap_tissue YFB_veil 0.694098 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034970
MIFNLHSIAVFIAATASLTSGVNAAPQAANTTLARVVRSCTKDKVAALTFDDGPTDYTIIAEYLLTKAGAKGTFF
VNGALWGCIYDQRRADTVKILYDRGHQIGSHTWSHPDLTLLSRDEIVPEMTRSHVAIERITGASPAFMRPPYGEY
NSLVQEVAASLGETIALWDLDPEDTTDKDVAYQRKQYDDAVNRKVKNVLSLQHDIKSQTVYLVLPYVIKKLQDAG
YKLVTLAECLGEQPYSKIGSPQQRTADWHC*
Coding >AgabiH97|034970
ATGATTTTTAACCTCCACTCTATCGCCGTATTCATCGCCGCTACCGCTAGTTTGACGTCTGGTGTGAATGCAGCT
CCTCAAGCAGCTAATACTACACTCGCTAGAGTCGTCAGAAGTTGTACAAAGGACAAAGTCGCAGCATTAACTTTT
GATGATGGACCCACTGATTACACGATCATTGCTGAGTATCTTTTGACTAAAGCAGGTGCAAAAGGCACATTTTTT
GTCAATGGAGCTCTTTGGGGATGTATCTATGATCAAAGACGCGCCGATACTGTAAAAATCTTGTATGACCGCGGA
CATCAAATTGGCTCGCATACTTGGTCGCACCCGGATCTCACTTTATTGTCTCGAGACGAAATTGTTCCAGAAATG
ACTAGGAGTCATGTGGCTATTGAGAGGATCACTGGTGCCAGTCCAGCATTTATGCGTCCGCCTTACGGGGAGTAT
AACAGTCTAGTGCAAGAGGTTGCAGCATCTCTAGGGGAAACTATCGCTCTGTGGGATTTGGATCCTGAAGACACA
ACCGATAAAGACGTAGCTTACCAGAGGAAACAATATGATGATGCAGTCAATAGGAAAGTGAAGAATGTGTTGTCG
TTACAGCATGATATCAAATCCCAAACTGTCTATCTCGTATTACCATATGTGATTAAGAAACTACAAGACGCCGGA
TACAAACTCGTGACACTGGCGGAATGCCTTGGTGAACAACCGTATTCCAAAATAGGATCTCCTCAACAGAGGACG
GCGGATTGGCATTGCTGA
Transcript >AgabiH97|034970
ATGATTTTTAACCTCCACTCTATCGCCGTATTCATCGCCGCTACCGCTAGTTTGACGTCTGGTGTGAATGCAGCT
CCTCAAGCAGCTAATACTACACTCGCTAGAGTCGTCAGAAGTTGTACAAAGGACAAAGTCGCAGCATTAACTTTT
GATGATGGACCCACTGATTACACGATCATTGCTGAGTATCTTTTGACTAAAGCAGGTGCAAAAGGCACATTTTTT
GTCAATGGAGCTCTTTGGGGATGTATCTATGATCAAAGACGCGCCGATACTGTAAAAATCTTGTATGACCGCGGA
CATCAAATTGGCTCGCATACTTGGTCGCACCCGGATCTCACTTTATTGTCTCGAGACGAAATTGTTCCAGAAATG
ACTAGGAGTCATGTGGCTATTGAGAGGATCACTGGTGCCAGTCCAGCATTTATGCGTCCGCCTTACGGGGAGTAT
AACAGTCTAGTGCAAGAGGTTGCAGCATCTCTAGGGGAAACTATCGCTCTGTGGGATTTGGATCCTGAAGACACA
ACCGATAAAGACGTAGCTTACCAGAGGAAACAATATGATGATGCAGTCAATAGGAAAGTGAAGAATGTGTTGTCG
TTACAGCATGATATCAAATCCCAAACTGTCTATCTCGTATTACCATATGTGATTAAGAAACTACAAGACGCCGGA
TACAAACTCGTGACACTGGCGGAATGCCTTGGTGAACAACCGTATTCCAAAATAGGATCTCCTCAACAGAGGACG
GCGGATTGGCATTGCTGA
Gene >AgabiH97|034970
ATGATTTTTAACCTCCACTCTATCGCCGTATTCATCGCCGCTACCGCTAGTTTGACGTCTGGTGTGAATGCAGCT
CCTCAAGCAGCTAATACTACACTCGCTAGAGTCGTCAGAAGTTGTACAAAGGACAAAGTCGCAGCATTAACTTTT
GTGCGTATCAAATCGCTCCTTTGAAGCATACTTGTTGACCTCATATCTTGTGACGTGTGTCTTTTTCCGACTATA
GGATGATGGACCCACTGATTACACGATCATTGCTGAGTATCTTTTGACTAAAGCAGGTGCAAAAGGCACATTTTT
TGTCAGTAAGTTGTCATTGTTATTTTCTTCTTCTACTGAACATCGAAGAACGCGTCTGATTTTTTTCTTATAGAT
GGAGCTCTTTGGGGATGTATCTATGATCAAAGACGCGCCGATACTGTAAAAATCTTGTATGACCGCGGACATCAA
ATTGGCTCGCATACTTGGTCGCACCCGGATCTCACTTTATTGTCTCGAGACGAAAGTATATTCTTCCGCTTCGTC
TAAGTCCGGCTTTGTTGCTGACATAGGAATATCTAGTTGTTCCAGAAATGACTAGGAGTCATGGTAAGTGCCTCT
GATTGAACGTCAATTTTCTCCAAATCGAATTATGCGTGTGGGGATTGTAGTGGCTATTGAGAGGATCACTGGTGC
CAGTCCAGCATTTATGCGTCCGCGTGAGTGTCGAATGGTGTTCAACCAAACTCATTTCGCTGACAAATAAATCTT
CAGCTTACGGGGAGTATAACAGTCTAGTGCAAGAGGTTGCAGCATCTCTAGGGGAAACTATCGCTCTGTGGGATT
TGGAGTAAGTTTTCAAATTCCTATTCGCCAAGTGCCAATTGTCGCGTATTGATCTGACTTTGGTTGATATTAGTC
CTGAAGACACAACCGATAAAGACGTAGCTTACCAGAGGAAACAATATGATGATGCAGTCAATAGGAAAGTGAAGA
ATGTGTTGTCGTTACAGCATGATATCAAATGTGCGCCTTGCATAGTTATGTATCTCGATGCTTGCTAACTCTGGA
CCATTTTCTTTTTCAATAGCCCAAACTGTCTATCTCGTATTACCATATGTGATTAAGAAACTACAAGACGCCGGA
TACAAACTCGTGACACTGGCGGAATGCCTTGGTGAACAACCGTATTCCAAAATAGGATCTCCTCAACAGAGGACG
GTAAGCTTATTTACTCTTCCAGAATCGTCTTTGTATCATTGACGGTTTGGAATACAGGCGGATTGGCATTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail