Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034830
Gene name
Locationscaffold_13:332488..333338
Strand+
Gene length (bp)850
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain 1.1E-32 129 212
PF10587 EF-1_beta_acid Eukaryotic elongation factor 1 beta central acidic region 4.7E-08 94 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30151|EF1B_XENLA Elongation factor 1-beta OS=Xenopus laevis GN=eef1b PE=1 SV=3 3 212 3.0E-72
sp|P12262|EF1B_ARTSA Elongation factor 1-beta OS=Artemia salina PE=1 SV=3 6 212 4.0E-69
sp|O74173|EF1B_SCHPO Elongation factor 1-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef5 PE=2 SV=1 3 212 6.0E-68
sp|P24534|EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens GN=EEF1B2 PE=1 SV=3 3 212 8.0E-68
sp|P34826|EF1B_RABIT Elongation factor 1-beta OS=Oryctolagus cuniculus GN=EEF1B PE=1 SV=2 3 212 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30151|EF1B_XENLA Elongation factor 1-beta OS=Xenopus laevis GN=eef1b PE=1 SV=3 3 212 3.0E-72
sp|P12262|EF1B_ARTSA Elongation factor 1-beta OS=Artemia salina PE=1 SV=3 6 212 4.0E-69
sp|O74173|EF1B_SCHPO Elongation factor 1-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef5 PE=2 SV=1 3 212 6.0E-68
sp|P24534|EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens GN=EEF1B2 PE=1 SV=3 3 212 8.0E-68
sp|P34826|EF1B_RABIT Elongation factor 1-beta OS=Oryctolagus cuniculus GN=EEF1B PE=1 SV=2 3 212 1.0E-66
sp|O70251|EF1B_MOUSE Elongation factor 1-beta OS=Mus musculus GN=Eef1b PE=1 SV=5 3 212 2.0E-66
sp|Q9YGQ1|EF1B_CHICK Elongation factor 1-beta OS=Gallus gallus GN=EEF1B PE=2 SV=3 2 212 2.0E-66
sp|Q5E983|EF1B_BOVIN Elongation factor 1-beta OS=Bos taurus GN=EEF1B PE=2 SV=3 3 212 3.0E-66
sp|Q6DET9|EF1B_XENTR Elongation factor 1-beta OS=Xenopus tropicalis GN=eef1b PE=2 SV=3 3 212 2.0E-63
sp|P29522|EF1B2_BOMMO Elongation factor 1-beta' OS=Bombyx mori PE=1 SV=2 5 212 1.0E-55
sp|Q9GRF8|EF1B_DICDI Elongation factor 1-beta OS=Dictyostelium discoideum GN=efa1B PE=1 SV=1 5 212 2.0E-54
sp|O96827|EF1B_DROME Probable elongation factor 1-beta OS=Drosophila melanogaster GN=Ef1beta PE=1 SV=3 5 212 9.0E-53
sp|P78590|EF1B_CANAW Elongation factor 1-beta OS=Candida albicans (strain WO-1) GN=EFB1 PE=3 SV=1 4 212 8.0E-52
sp|P32192|EF1D_ARTSA Elongation factor 1-delta OS=Artemia salina PE=1 SV=2 84 212 4.0E-50
sp|P29412|EF1B_PIG Elongation factor 1-beta OS=Sus scrofa GN=EEF1B PE=1 SV=1 3 212 2.0E-47
sp|P34460|EF1B1_CAEEL Probable elongation factor 1-beta/1-delta 1 OS=Caenorhabditis elegans GN=eef-1B.1 PE=1 SV=1 3 212 2.0E-46
sp|A5D989|EF1D_BOVIN Elongation factor 1-delta OS=Bos taurus GN=EEF1D PE=2 SV=2 94 212 6.0E-45
sp|P29693|EF1D_XENLA Elongation factor 1-delta OS=Xenopus laevis GN=eef1d PE=1 SV=1 95 212 1.0E-44
sp|P53787|EF1D_RABIT Elongation factor 1-delta OS=Oryctolagus cuniculus GN=EEF1D PE=2 SV=1 94 212 1.0E-44
sp|P32471|EF1B_YEAST Elongation factor 1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFB1 PE=1 SV=4 4 212 2.0E-44
sp|Q68FR9|EF1D_RAT Elongation factor 1-delta OS=Rattus norvegicus GN=Eef1d PE=1 SV=2 76 212 7.0E-44
sp|P93447|EF1D_PIMBR Elongation factor 1-delta OS=Pimpinella brachycarpa PE=2 SV=3 3 212 1.0E-43
sp|Q4R3D4|EF1D_MACFA Elongation factor 1-delta OS=Macaca fascicularis GN=EEF1D PE=2 SV=2 95 212 2.0E-43
sp|P29692|EF1D_HUMAN Elongation factor 1-delta OS=Homo sapiens GN=EEF1D PE=1 SV=5 95 212 3.0E-43
sp|P57776|EF1D_MOUSE Elongation factor 1-delta OS=Mus musculus GN=Eef1d PE=1 SV=3 76 212 3.0E-43
sp|Q40680|EF1D1_ORYSJ Elongation factor 1-delta 1 OS=Oryza sativa subsp. japonica GN=Os07g0614500 PE=2 SV=3 3 212 4.0E-37
sp|Q40682|EF1D2_ORYSJ Elongation factor 1-delta 2 OS=Oryza sativa subsp. japonica GN=Os03g0406200 PE=2 SV=3 3 212 1.0E-36
sp|Q9SI20|EF1D2_ARATH Elongation factor 1-delta 2 OS=Arabidopsis thaliana GN=At2g18110 PE=1 SV=1 3 212 2.0E-36
sp|P48006|EF1D1_ARATH Elongation factor 1-delta 1 OS=Arabidopsis thaliana GN=At1g30230 PE=1 SV=2 3 212 5.0E-35
sp|Q717R8|EF1D_SHEEP Elongation factor 1-delta OS=Ovis aries GN=EEF1D PE=2 SV=1 94 212 7.0E-35
sp|Q9SCX3|EF1B2_ARATH Elongation factor 1-beta 2 OS=Arabidopsis thaliana GN=At5g19510 PE=1 SV=1 4 212 3.0E-33
sp|Q9VL18|EF1D_DROME Probable elongation factor 1-delta OS=Drosophila melanogaster GN=eEF1delta PE=1 SV=1 96 212 4.0E-33
sp|P29545|EF1B_ORYSJ Elongation factor 1-beta OS=Oryza sativa subsp. japonica GN=Os07g0662500 PE=1 SV=3 4 212 4.0E-32
sp|Q84WM9|EF1B1_ARATH Elongation factor 1-beta 1 OS=Arabidopsis thaliana GN=At5g12110 PE=2 SV=2 4 212 4.0E-32
sp|Q9U2H9|EF1B2_CAEEL Probable elongation factor 1-beta/1-delta 2 OS=Caenorhabditis elegans GN=eef-1B.2 PE=1 SV=4 87 212 3.0E-31
sp|P29546|EF1B_WHEAT Elongation factor 1-beta OS=Triticum aestivum PE=1 SV=2 4 212 2.0E-30
sp|P34827|EF1B_TRYCR 25 kDa elongation factor 1-beta OS=Trypanosoma cruzi PE=2 SV=1 8 212 1.0E-24
sp|O81918|EF1D_BETVU Elongation factor 1-delta OS=Beta vulgaris PE=2 SV=3 125 212 4.0E-24
sp|Q9ER72|SYCC_MOUSE Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2 2 55 7.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006414 translational elongation Yes
GO:0003746 translation elongation factor activity Yes
GO:0097159 organic cyclic compound binding No
GO:0045182 translation regulator activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008135 translation factor activity, RNA binding No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0009059 macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034830
MSANLQKLNDHLASRSYVEGYTPSQADVHVLKAISSDPDAKKYPHVARWYTHIKSYAAEHGSLPGSSTAGEVFLG
GASSAEADDDDDDDFDLESDDEADAEAEKIKAQRVAEYNAKKANKPKTVAKSVVTLDVKPWDDETDMAALEAAVR
GIEQDGLLWGASKLVAIGYGIKKLQITLVVEDEKVSTDELQEKIAEFEDYVQSSDIAAMQKL*
Coding >AgabiH97|034830
ATGTCCGCAAACCTCCAAAAATTGAATGATCATCTCGCCTCGAGGTCATATGTTGAAGGATACACCCCTTCCCAA
GCCGATGTTCATGTCTTGAAAGCGATCTCCTCTGATCCAGACGCAAAAAAATACCCTCATGTTGCCCGATGGTAC
ACCCACATTAAGTCATATGCTGCCGAGCATGGTTCCCTTCCCGGATCTAGCACTGCTGGCGAGGTATTCCTCGGC
GGTGCTTCCTCGGCAGAGGCCGACGACGACGACGACGATGACTTTGATCTTGAATCCGATGACGAAGCAGATGCC
GAGGCAGAGAAAATAAAGGCCCAACGTGTCGCTGAGTATAACGCGAAGAAGGCCAATAAACCCAAAACCGTCGCA
AAGTCTGTTGTAACTCTCGATGTAAAACCATGGGATGATGAAACCGACATGGCTGCACTTGAAGCTGCCGTTCGT
GGCATTGAACAAGATGGCCTCTTGTGGGGTGCTAGCAAGCTCGTCGCCATTGGATATGGTATCAAGAAACTTCAG
ATTACGCTTGTCGTTGAGGACGAAAAAGTTTCCACGGATGAACTGCAAGAGAAGATTGCGGAGTTCGAAGACTAT
GTCCAAAGTTCTGATATCGCCGCTATGCAAAAACTCTAG
Transcript >AgabiH97|034830
ATGTCCGCAAACCTCCAAAAATTGAATGATCATCTCGCCTCGAGGTCATATGTTGAAGGATACACCCCTTCCCAA
GCCGATGTTCATGTCTTGAAAGCGATCTCCTCTGATCCAGACGCAAAAAAATACCCTCATGTTGCCCGATGGTAC
ACCCACATTAAGTCATATGCTGCCGAGCATGGTTCCCTTCCCGGATCTAGCACTGCTGGCGAGGTATTCCTCGGC
GGTGCTTCCTCGGCAGAGGCCGACGACGACGACGACGATGACTTTGATCTTGAATCCGATGACGAAGCAGATGCC
GAGGCAGAGAAAATAAAGGCCCAACGTGTCGCTGAGTATAACGCGAAGAAGGCCAATAAACCCAAAACCGTCGCA
AAGTCTGTTGTAACTCTCGATGTAAAACCATGGGATGATGAAACCGACATGGCTGCACTTGAAGCTGCCGTTCGT
GGCATTGAACAAGATGGCCTCTTGTGGGGTGCTAGCAAGCTCGTCGCCATTGGATATGGTATCAAGAAACTTCAG
ATTACGCTTGTCGTTGAGGACGAAAAAGTTTCCACGGATGAACTGCAAGAGAAGATTGCGGAGTTCGAAGACTAT
GTCCAAAGTTCTGATATCGCCGCTATGCAAAAACTCTAG
Gene >AgabiH97|034830
ATGTCCGCAAACCTCCAAAAATTGAATGATCATCTCGCCTCGAGGTCATATGTTGAAGGGTGAGCACTTAACAGC
CTAGACTCTCGACTAGAATGTTAACCCTTTCACAGATACACCCCTTCCCAAGCCGATGTTCATGTCTTGAAAGCG
ATCTCCTCTGATCCAGACGCAAAAAAATACCCTCATGTTGCCCGATGGTACACCCACATTAAGTCATATGCTGCC
GAGCATGGTTCCCTTCCCGGATCTAGCACTGCTGGCGAGGTATTCCTCGGCGGTGCTTCCTCGGCAGAGGCCGAC
GACGACGACGACGATGACTTTGATCTTGAATCCGATGACGAAGCAGATGCCGAGGCAGAGAAAATAAAGGCCCAA
CGTGTCGCTGAGTATAACGCGAAGAAGGCCAATAAACCCAAAACCGTCGCAAAGGTATGAACGCCCATAAAGAGG
ACTAACCTGCGAGCTGATGTCCCTGAAAAGTCTGTTGTAACTCTCGATGTAAAACCATGGGATGATGAAACCGAC
ATGGCTGCACTTGAAGCTGCCGTTCGTGGCATTGAACAAGATGGCCTCTTGTGGGGTGCTAGCAAGCTCGTCGCC
ATTGGATATGGTATCAAGAAACTTCAGATTACGCTTGTCGTTGGTATGTCGCCACTATCACAGCATACTCAAGAC
TGCCAGCTCTTACCAACTGTGTAGAGGACGAAAAAGTTTCCACGGATGAACTGCAAGAGAAGATTGCGGAGTTCG
AAGACTATGTCCAAAGTTCTGATATCGCCGCTATGCAAAGTAAGCAATCATGCCTTAAGTGCCCGCAACAAGTTA
ACTCACTTTTCTTCTAGAACTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail