Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034720
Gene name
Locationscaffold_13:307989..309785
Strand+
Gene length (bp)1796
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 8.5E-12 257 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A1E3|CBF1_CANAL Transcriptional regulator CBF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBF1 PE=1 SV=1 246 343 8.0E-27
sp|P17106|CBF1_YEAST Centromere-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBF1 PE=1 SV=2 240 360 5.0E-20
sp|Q10186|YAWC_SCHPO Uncharacterized bHLH domain-containing protein C3F10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3F10.12c PE=3 SV=1 231 342 1.0E-18
sp|P49379|CBF1_KLULA Centromere-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBF1 PE=3 SV=2 249 331 3.0E-18
sp|Q64092|TFE3_MOUSE Transcription factor E3 OS=Mus musculus GN=Tfe3 PE=1 SV=2 255 339 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A1E3|CBF1_CANAL Transcriptional regulator CBF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBF1 PE=1 SV=1 246 343 8.0E-27
sp|P17106|CBF1_YEAST Centromere-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBF1 PE=1 SV=2 240 360 5.0E-20
sp|Q10186|YAWC_SCHPO Uncharacterized bHLH domain-containing protein C3F10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3F10.12c PE=3 SV=1 231 342 1.0E-18
sp|P49379|CBF1_KLULA Centromere-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBF1 PE=3 SV=2 249 331 3.0E-18
sp|Q64092|TFE3_MOUSE Transcription factor E3 OS=Mus musculus GN=Tfe3 PE=1 SV=2 255 339 2.0E-10
sp|Q05B92|TFE3_BOVIN Transcription factor E3 OS=Bos taurus GN=TFE3 PE=2 SV=1 255 339 7.0E-10
sp|P19532|TFE3_HUMAN Transcription factor E3 OS=Homo sapiens GN=TFE3 PE=1 SV=4 255 339 1.0E-09
sp|Q15853|USF2_HUMAN Upstream stimulatory factor 2 OS=Homo sapiens GN=USF2 PE=1 SV=1 256 339 5.0E-09
sp|Q08874|MITF_MOUSE Microphthalmia-associated transcription factor OS=Mus musculus GN=Mitf PE=1 SV=3 255 312 5.0E-09
sp|O75030|MITF_HUMAN Microphthalmia-associated transcription factor OS=Homo sapiens GN=MITF PE=1 SV=2 255 312 7.0E-09
sp|Q9R210|TFEB_MOUSE Transcription factor EB OS=Mus musculus GN=Tfeb PE=1 SV=2 255 315 8.0E-09
sp|Q64705|USF2_MOUSE Upstream stimulatory factor 2 OS=Mus musculus GN=Usf2 PE=1 SV=1 256 360 1.0E-08
sp|P19484|TFEB_HUMAN Transcription factor EB OS=Homo sapiens GN=TFEB PE=1 SV=3 255 315 1.0E-08
sp|Q63665|USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus GN=Usf2 PE=1 SV=2 256 360 1.0E-08
sp|O88368|MITF_RAT Microphthalmia-associated transcription factor (Fragment) OS=Rattus norvegicus GN=Mitf PE=2 SV=1 255 312 2.0E-08
sp|Q07957|USF1_XENBO Upstream stimulatory factor 1 OS=Xenopus borealis GN=usf1 PE=2 SV=1 256 339 5.0E-08
sp|P34474|HLH11_CAEEL Helix-loop-helix protein 11 OS=Caenorhabditis elegans GN=hlh-11 PE=3 SV=3 247 360 5.0E-08
sp|O02818|USF1_RABIT Upstream stimulatory factor 1 OS=Oryctolagus cuniculus GN=USF1 PE=2 SV=1 256 339 2.0E-07
sp|Q6XBT4|USF1_BOVIN Upstream stimulatory factor 1 OS=Bos taurus GN=USF1 PE=2 SV=1 256 339 2.0E-07
sp|P22415|USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens GN=USF1 PE=1 SV=1 256 339 2.0E-07
sp|Q61069|USF1_MOUSE Upstream stimulatory factor 1 OS=Mus musculus GN=Usf1 PE=1 SV=1 256 339 2.0E-07
sp|Q07956|USF_STRPU Upstream stimulatory factor OS=Strongylocentrotus purpuratus PE=2 SV=1 256 312 2.0E-06
sp|Q0VH32|MNT_XENLA Max-binding protein MNT OS=Xenopus laevis GN=mnt PE=2 SV=1 236 365 3.0E-06
sp|Q68DE3|K2018_HUMAN Basic helix-loop-helix domain-containing protein KIAA2018 OS=Homo sapiens GN=KIAA2018 PE=1 SV=3 255 398 8.0E-06
sp|Q01664|TFAP4_HUMAN Transcription factor AP-4 OS=Homo sapiens GN=TFAP4 PE=1 SV=2 234 359 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 23.72 13.04 34.39
Initials Initials knots 20.60 11.09 30.12
Pileal_Stipeal_center Stage I stipe center 25.68 14.25 37.10
Pileal_Stipeal_shell Stage I stipe shell 32.40 18.24 46.55
DIF_stipe_center Stage II stipe center 28.42 16.03 40.81
DIF_stipe_shell Stage II stipe shell 23.42 12.89 33.94
DIF_stipe_skin Stage II stipe skin 22.50 12.24 32.76
DIF_cap_skin Stage II cap skin 33.97 19.51 48.43
DIF_cap_tissue Stage II cap tissue 33.44 19.21 47.68
DIF_gill_tissue Stage II gill tissue 32.13 18.37 45.89
YFB_stipe_center Young fruiting body stipe center 24.56 13.54 35.59
YFB_stipe_shell Young fruiting body stipe shell 24.87 13.70 36.04
YFB_stipe_skin Young fruiting body stipe skin 21.10 11.39 30.80
YFB_cap_skin Young fruiting body cap skin 32.83 18.44 47.23
YFB_cap_tissue Young fruiting body cap tissue 33.57 19.15 47.99
YFB_gill_tissue Young fruiting body gill tissue 28.73 16.21 41.25
YFB_veil Young fruiting body veil 30.59 17.30 43.88

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.388089 no
Casing YFB_stipe_center 0.955072 no
Casing YFB_stipe_shell 0.937312 no
Casing YFB_stipe_skin 0.823003 no
Casing YFB_cap_skin 0.355529 no
Casing YFB_cap_tissue 0.298605 no
Casing YFB_gill_tissue 0.656939 no
Casing YFB_veil 0.508576 no
Casing Initials 0.774071 no
Casing Pileal_Stipeal_center 0.887611 no
Casing Pileal_Stipeal_shell 0.386183 no
Casing DIF_stipe_center 0.675446 no
Casing DIF_stipe_shell 0.983812 no
Casing DIF_stipe_skin 0.930180 no
Casing DIF_cap_skin 0.290161 no
Casing DIF_cap_tissue 0.313257 no
DIF_gill_tissue YFB_stipe_center 0.473320 no
DIF_gill_tissue YFB_stipe_shell 0.498538 no
DIF_gill_tissue YFB_stipe_skin 0.194728 no
DIF_gill_tissue YFB_cap_skin 0.971330 no
DIF_gill_tissue YFB_cap_tissue 0.937270 no
DIF_gill_tissue YFB_gill_tissue 0.822078 no
DIF_gill_tissue YFB_veil 0.932005 no
YFB_stipe_center YFB_stipe_shell 0.984130 no
YFB_stipe_center YFB_stipe_skin 0.754323 no
YFB_stipe_center YFB_cap_skin 0.430182 no
YFB_stipe_center YFB_cap_tissue 0.369699 no
YFB_stipe_center YFB_gill_tissue 0.737742 no
YFB_stipe_center YFB_veil 0.593805 no
YFB_stipe_shell YFB_stipe_skin 0.725048 no
YFB_stipe_shell YFB_cap_skin 0.456929 no
YFB_stipe_shell YFB_cap_tissue 0.395131 no
YFB_stipe_shell YFB_gill_tissue 0.763143 no
YFB_stipe_shell YFB_veil 0.622172 no
YFB_stipe_skin YFB_cap_skin 0.172433 no
YFB_stipe_skin YFB_cap_tissue 0.141946 no
YFB_stipe_skin YFB_gill_tissue 0.416514 no
YFB_stipe_skin YFB_veil 0.286505 no
YFB_cap_skin YFB_cap_tissue 0.969772 no
YFB_cap_skin YFB_gill_tissue 0.781355 no
YFB_cap_skin YFB_veil 0.898576 no
YFB_cap_tissue YFB_gill_tissue 0.723870 no
YFB_cap_tissue YFB_veil 0.856171 no
YFB_gill_tissue YFB_veil 0.911766 no
Initials DIF_gill_tissue 0.161964 no
Initials YFB_stipe_center 0.705096 no
Initials YFB_stipe_shell 0.677632 no
Initials YFB_stipe_skin 0.969405 no
Initials YFB_cap_skin 0.140843 no
Initials YFB_cap_tissue 0.115346 no
Initials YFB_gill_tissue 0.362965 no
Initials YFB_veil 0.242880 no
Initials Pileal_Stipeal_center 0.609082 no
Initials Pileal_Stipeal_shell 0.166316 no
Initials DIF_stipe_center 0.374405 no
Initials DIF_stipe_shell 0.798991 no
Initials DIF_stipe_skin 0.873946 no
Initials DIF_cap_skin 0.109778 no
Initials DIF_cap_tissue 0.122169 no
Pileal_Stipeal_center DIF_gill_tissue 0.570435 no
Pileal_Stipeal_center YFB_stipe_center 0.941443 no
Pileal_Stipeal_center YFB_stipe_shell 0.957828 no
Pileal_Stipeal_center YFB_stipe_skin 0.653731 no
Pileal_Stipeal_center YFB_cap_skin 0.528753 no
Pileal_Stipeal_center YFB_cap_tissue 0.467553 no
Pileal_Stipeal_center YFB_gill_tissue 0.824856 no
Pileal_Stipeal_center YFB_veil 0.691606 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.563590 no
Pileal_Stipeal_center DIF_stipe_center 0.844554 no
Pileal_Stipeal_center DIF_stipe_shell 0.861481 no
Pileal_Stipeal_center DIF_stipe_skin 0.790316 no
Pileal_Stipeal_center DIF_cap_skin 0.451287 no
Pileal_Stipeal_center DIF_cap_tissue 0.483378 no
Pileal_Stipeal_shell DIF_gill_tissue 0.988832 no
Pileal_Stipeal_shell YFB_stipe_center 0.465634 no
Pileal_Stipeal_shell YFB_stipe_shell 0.491022 no
Pileal_Stipeal_shell YFB_stipe_skin 0.195326 no
Pileal_Stipeal_shell YFB_cap_skin 0.982285 no
Pileal_Stipeal_shell YFB_cap_tissue 0.951753 no
Pileal_Stipeal_shell YFB_gill_tissue 0.810120 no
Pileal_Stipeal_shell YFB_veil 0.921017 no
Pileal_Stipeal_shell DIF_stipe_center 0.785966 no
Pileal_Stipeal_shell DIF_stipe_shell 0.358490 no
Pileal_Stipeal_shell DIF_stipe_skin 0.297681 no
Pileal_Stipeal_shell DIF_cap_skin 0.935348 no
Pileal_Stipeal_shell DIF_cap_tissue 0.957888 no
DIF_stipe_center DIF_gill_tissue 0.802656 no
DIF_stipe_center YFB_stipe_center 0.760131 no
DIF_stipe_center YFB_stipe_shell 0.784291 no
DIF_stipe_center YFB_stipe_skin 0.428612 no
DIF_stipe_center YFB_cap_skin 0.760331 no
DIF_stipe_center YFB_cap_tissue 0.702937 no
DIF_stipe_center YFB_gill_tissue 0.985394 no
DIF_stipe_center YFB_veil 0.893840 no
DIF_stipe_center DIF_stipe_shell 0.648980 no
DIF_stipe_center DIF_stipe_skin 0.570190 no
DIF_stipe_center DIF_cap_skin 0.680313 no
DIF_stipe_center DIF_cap_tissue 0.713353 no
DIF_stipe_shell DIF_gill_tissue 0.363051 no
DIF_stipe_shell YFB_stipe_center 0.936428 no
DIF_stipe_shell YFB_stipe_shell 0.917324 no
DIF_stipe_shell YFB_stipe_skin 0.845429 no
DIF_stipe_shell YFB_cap_skin 0.330737 no
DIF_stipe_shell YFB_cap_tissue 0.273655 no
DIF_stipe_shell YFB_gill_tissue 0.630905 no
DIF_stipe_shell YFB_veil 0.483378 no
DIF_stipe_shell DIF_stipe_skin 0.948175 no
DIF_stipe_shell DIF_cap_skin 0.267461 no
DIF_stipe_shell DIF_cap_tissue 0.287492 no
DIF_stipe_skin DIF_gill_tissue 0.296498 no
DIF_stipe_skin YFB_stipe_center 0.875651 no
DIF_stipe_skin YFB_stipe_shell 0.853107 no
DIF_stipe_skin YFB_stipe_skin 0.912997 no
DIF_stipe_skin YFB_cap_skin 0.265645 no
DIF_stipe_skin YFB_cap_tissue 0.223600 no
DIF_stipe_skin YFB_gill_tissue 0.546417 no
DIF_stipe_skin YFB_veil 0.410707 no
DIF_stipe_skin DIF_cap_skin 0.213894 no
DIF_stipe_skin DIF_cap_tissue 0.233086 no
DIF_cap_skin DIF_gill_tissue 0.921763 no
DIF_cap_skin YFB_stipe_center 0.356963 no
DIF_cap_skin YFB_stipe_shell 0.379525 no
DIF_cap_skin YFB_stipe_skin 0.131844 no
DIF_cap_skin YFB_cap_skin 0.954910 no
DIF_cap_skin YFB_cap_tissue 0.983711 no
DIF_cap_skin YFB_gill_tissue 0.703809 no
DIF_cap_skin YFB_veil 0.836911 no
DIF_cap_skin DIF_cap_tissue 0.979318 no
DIF_cap_tissue DIF_gill_tissue 0.946271 no
DIF_cap_tissue YFB_stipe_center 0.386972 no
DIF_cap_tissue YFB_stipe_shell 0.410165 no
DIF_cap_tissue YFB_stipe_skin 0.151108 no
DIF_cap_tissue YFB_cap_skin 0.976329 no
DIF_cap_tissue YFB_cap_tissue 0.994301 no
DIF_cap_tissue YFB_gill_tissue 0.740865 no
DIF_cap_tissue YFB_veil 0.866473 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034720
MTWQVTGFLITAVVTCTPPYPTLPSSLSTVYRTNTVHFVSAAWRPFQPCRQTLFASQDPGLAQPPSNPPQVQASQ
PQAGVPPTIPPASDMSNVHLTGGFDQNQIMSLLRHLPNVFGKLTEQGPKEDAAQALSNLAAHPGFSPAAVQAVHY
PTSTGLPGINDPGPSSHPRGPPNLGQLSAVALQATPATVQQSRPEGSPTDERTAQQLQQQVAQAVQAATGGSPGD
KPPSPTSPGGGSSSGSRRRNPAMGSDEWTRQRKDNHKEVERRRRGNINEGINELGRIVPSGNGEKAKGAILARSV
QYIHHLKENEARNIEKWTLEKLLMDQAMGDLQNQLEEVKRMWEEERNARQRLEMEVESLRNSAANGVASALPPPA
ASGTNVKSSDSGAIDPATGNKRKSEEVGEQTNGTATANGDGDRDGKRQRTD*
Coding >AgabiH97|034720
ATGACCTGGCAGGTCACAGGGTTTCTGATCACGGCCGTCGTGACTTGCACGCCCCCATATCCCACCCTCCCCTCC
TCGCTGAGCACCGTCTATCGCACCAATACAGTCCATTTCGTTTCTGCAGCTTGGCGCCCCTTTCAGCCTTGTCGC
CAGACCCTTTTTGCTAGCCAAGACCCTGGCCTTGCGCAGCCTCCTTCCAATCCTCCGCAAGTGCAAGCATCACAA
CCTCAAGCAGGCGTACCACCTACCATTCCCCCAGCTTCAGATATGTCCAACGTTCACCTCACCGGTGGCTTCGAT
CAGAATCAGATTATGTCTCTACTTCGCCATCTACCCAATGTCTTTGGCAAGCTCACAGAACAAGGCCCGAAAGAA
GATGCTGCTCAGGCTCTTTCGAACCTGGCTGCGCATCCCGGTTTTTCCCCGGCAGCTGTCCAGGCTGTTCACTAT
CCAACCTCGACTGGACTACCGGGCATCAACGACCCTGGACCATCCTCCCACCCCCGCGGCCCTCCCAATTTGGGT
CAATTAAGTGCTGTTGCTTTACAAGCAACACCAGCTACTGTACAACAAAGTCGACCGGAGGGTTCACCCACAGAT
GAACGCACGGCGCAACAGCTGCAGCAGCAGGTCGCCCAGGCGGTCCAAGCTGCCACCGGCGGTTCTCCGGGAGAC
AAGCCTCCCAGCCCTACGTCACCAGGTGGGGGCTCATCCAGTGGCAGTCGCCGAAGGAATCCAGCTATGGGAAGC
GACGAATGGACGAGGCAGAGGAAAGATAACCACAAAGAAGTTGAGCGTCGCCGCCGTGGTAACATCAATGAAGGC
ATCAATGAACTTGGTCGCATAGTACCGAGCGGGAACGGAGAAAAGGCGAAAGGCGCTATTCTTGCGCGCTCCGTG
CAATACATCCACCACCTGAAGGAGAACGAGGCACGGAATATCGAAAAATGGACTTTGGAGAAACTTCTTATGGAC
CAAGCCATGGGAGACCTCCAAAACCAACTGGAAGAAGTCAAGCGTATGTGGGAAGAAGAGCGTAATGCCCGACAA
CGCTTGGAGATGGAAGTGGAATCTCTTCGGAATAGTGCCGCCAATGGCGTAGCATCCGCTCTTCCCCCGCCTGCT
GCTTCGGGAACGAACGTCAAATCGTCCGACTCGGGGGCTATTGACCCTGCCACGGGAAACAAACGAAAAAGCGAG
GAGGTTGGCGAACAGACAAATGGCACCGCAACCGCTAATGGCGATGGTGACAGAGATGGCAAGCGGCAGCGAACA
GATTGA
Transcript >AgabiH97|034720
ATGACCTGGCAGGTCACAGGGTTTCTGATCACGGCCGTCGTGACTTGCACGCCCCCATATCCCACCCTCCCCTCC
TCGCTGAGCACCGTCTATCGCACCAATACAGTCCATTTCGTTTCTGCAGCTTGGCGCCCCTTTCAGCCTTGTCGC
CAGACCCTTTTTGCTAGCCAAGACCCTGGCCTTGCGCAGCCTCCTTCCAATCCTCCGCAAGTGCAAGCATCACAA
CCTCAAGCAGGCGTACCACCTACCATTCCCCCAGCTTCAGATATGTCCAACGTTCACCTCACCGGTGGCTTCGAT
CAGAATCAGATTATGTCTCTACTTCGCCATCTACCCAATGTCTTTGGCAAGCTCACAGAACAAGGCCCGAAAGAA
GATGCTGCTCAGGCTCTTTCGAACCTGGCTGCGCATCCCGGTTTTTCCCCGGCAGCTGTCCAGGCTGTTCACTAT
CCAACCTCGACTGGACTACCGGGCATCAACGACCCTGGACCATCCTCCCACCCCCGCGGCCCTCCCAATTTGGGT
CAATTAAGTGCTGTTGCTTTACAAGCAACACCAGCTACTGTACAACAAAGTCGACCGGAGGGTTCACCCACAGAT
GAACGCACGGCGCAACAGCTGCAGCAGCAGGTCGCCCAGGCGGTCCAAGCTGCCACCGGCGGTTCTCCGGGAGAC
AAGCCTCCCAGCCCTACGTCACCAGGTGGGGGCTCATCCAGTGGCAGTCGCCGAAGGAATCCAGCTATGGGAAGC
GACGAATGGACGAGGCAGAGGAAAGATAACCACAAAGAAGTTGAGCGTCGCCGCCGTGGTAACATCAATGAAGGC
ATCAATGAACTTGGTCGCATAGTACCGAGCGGGAACGGAGAAAAGGCGAAAGGCGCTATTCTTGCGCGCTCCGTG
CAATACATCCACCACCTGAAGGAGAACGAGGCACGGAATATCGAAAAATGGACTTTGGAGAAACTTCTTATGGAC
CAAGCCATGGGAGACCTCCAAAACCAACTGGAAGAAGTCAAGCGTATGTGGGAAGAAGAGCGTAATGCCCGACAA
CGCTTGGAGATGGAAGTGGAATCTCTTCGGAATAGTGCCGCCAATGGCGTAGCATCCGCTCTTCCCCCGCCTGCT
GCTTCGGGAACGAACGTCAAATCGTCCGACTCGGGGGCTATTGACCCTGCCACGGGAAACAAACGAAAAAGCGAG
GAGGTTGGCGAACAGACAAATGGCACCGCAACCGCTAATGGCGATGGTGACAGAGATGGCAAGCGGCAGCGAACA
GATTGA
Gene >AgabiH97|034720
ATGACCTGGCAGGTCACAGGGTTTCTGATCACGGCCGTCGTGACTTGCACGCCCCCATATCCCACCCTCCCCTCC
TCGCTGAGCACCGTCTATCGCACCAATACAGTCCATTTCGTTTCTGCAGCTTGGCGCCCGTAAGATTTGTATTGG
TTTCTGTACTTTACTTCACCGTTCACACTCCCGCCGTTCTTCCTGTCTAGCTTTCAGCCTTGTCGCCAGTGTCAC
CTCAATCACCTCTGAACCCACACGCATCGCAGCTCTCGCTGTCTAGCCCTTTCCCCCGTTTCATAGGACCCTTTT
TGTCTGTCAAAGCGTCCGTTTATTTTCCCTGCCATCGAGACTCTAATGGCTCCCACAAACCAGGCTAGCCAAGAC
CCTGGCCTTGCGCAGCCTCCTTCCAATCCTCCGCAAGTGCAAGCATCACAACCTCAAGCAGGCGTACCACCTACC
ATTCCCCCAGCTTCAGATATGTCCAACGTTCACCTCACCGGTGGCTTCGATCAGAATCAGATTATGTCTCTACTT
CGCCATCTACCCAATGTCTTTGGCAAGGTGAGCTTCCCGTTTATGTTTACCCGGCCGGTTGCTTCTCCCCCCGCC
TCTCTCCTTCTATGTTTATCGTTCTTTATATATCAGTGTGGAATGCTCTTCTGCAATCGCATCAATTACATTAAT
TAACTACACGTGACCGTATATCGTTCGCGACGCCGAGCACGAGCGCGTTCGATGCAAGTCACGGGGAGACGTCTT
TTTCTGCTATGCTTATCAGCAATCAACTTGACCGTGCTGATTATTCCGTCTTCAGCTCACAGAACAAGGCCCGAA
AGAAGATGCTGCTCAGGCTCTTTCGAACCTGGCTGCGCATCCCGGTTTTTCCCCGGCAGCTGTCCAGGCTGTTCA
CTATCCAACCTCGACTGGACTACCGGGCATCAACGACCCTGGACCATCCTCCCACCCCCGCGGCCCTCCCAATTT
GGGTCAATTAAGTGCTGTTGCTTTACAAGCAACACCAGCTACTGTACAACAAAGTCGACCGGAGGGTTCACCCAC
AGATGAACGCACGGCGCAACAGCTGCAGCAGCAGGTCGCCCAGGCGGTCCAAGCTGCCACCGGCGGTTCTCCGGG
AGACAAGCCTCCCAGCCCTACGTCACCAGGTGGGGGCTCATCCAGTGGCAGTCGCCGAAGGAATCCAGCTATGGG
AAGCGACGAATGGACGAGGCAGAGGAAAGATAACCACGTATGTGTTTCCTGCTCTTACATTGGTCCCTGCCACCT
GTCAACTAACGAATCAACAACAGAAAGAAGTTGAGCGTCGCCGCCGTGGTAACATCAATGAAGGCATCAATGAAC
TTGGTCGCATAGTACCGAGCGGGAACGGAGAAAAGGCGAAAGGCGCTATTCTTGCGCGCTCCGTGCAATACATCC
ACCACCTGAAGGAGAACGAGGCACGGAATATCGAAAAATGGACTTTGGAGAAACTTCTTATGGACCAAGCCATGG
GAGACCTCCAAAACCAACTGGAAGAAGTCAAGCGTATGTGGGAAGAAGAGCGTAATGCCCGACAACGCTTGGAGA
TGGAAGTGGAATCTCTTCGGAATAGTGCCGCCAATGGCGTAGCATCCGCTCTTCCCCCGCCTGCTGCTTCGGGAA
CGAACGTCAAATCGTCCGACTCGGGGGCTATTGACCCTGCCACGGGAAACAAACGAAAAAGCGAGGAGGTTGGCG
AACAGACAAATGGCACCGCAACCGCTAATGGCGATGGTGACAGAGATGGCAAGCGGCAGCGAACAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail