Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034660
Gene name
Locationscaffold_13:283134..286831
Strand-
Gene length (bp)3697
Transcript length (bp)3132
Coding sequence length (bp)3132
Protein length (aa) 1044

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 2.0E-130 171 665
PF02358 Trehalose_PPase Trehalose-phosphatase 1.2E-20 732 898

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.16c PE=1 SV=1 82 862 5.0E-124
sp|Q9UUI7|TPSY_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.05 PE=1 SV=1 143 898 1.0E-121
sp|P38427|TSL1_YEAST Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSL1 PE=1 SV=1 162 867 2.0E-111
sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 171 903 3.0E-102
sp|Q54NU9|TPSB_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum GN=tpsB PE=3 SV=1 175 899 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.16c PE=1 SV=1 82 862 5.0E-124
sp|Q9UUI7|TPSY_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.05 PE=1 SV=1 143 898 1.0E-121
sp|P38427|TSL1_YEAST Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSL1 PE=1 SV=1 162 867 2.0E-111
sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 171 903 3.0E-102
sp|Q54NU9|TPSB_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum GN=tpsB PE=3 SV=1 175 899 1.0E-98
sp|Q9SYM4|TPS1_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana GN=TPS1 PE=1 SV=1 172 898 2.0E-96
sp|P38426|TPS3_YEAST Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS3 PE=1 SV=3 41 869 3.0E-96
sp|Q9FZ57|TPS2_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana GN=TPS2 PE=3 SV=1 162 898 6.0E-92
sp|Q9T079|TPS4_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 4 OS=Arabidopsis thaliana GN=TPS4 PE=3 SV=1 159 898 1.0E-85
sp|O14145|TPS2_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps2 PE=3 SV=1 236 902 2.0E-83
sp|Q9SHG0|TPS3_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 3 OS=Arabidopsis thaliana GN=TPS3 PE=3 SV=3 201 898 6.0E-83
sp|O74932|TPS1_YARLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPS1 PE=2 SV=1 207 669 2.0E-78
sp|P40387|TPS1_SCHPO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps1 PE=1 SV=2 171 673 3.0E-78
sp|Q00764|TPS1_YEAST Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS1 PE=1 SV=2 128 666 5.0E-78
sp|O94213|TPS1_PICAN Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pichia angusta GN=TPS1 PE=3 SV=1 171 669 9.0E-78
sp|P78875|TPP1_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpp1 PE=1 SV=2 190 963 2.0E-77
sp|Q07158|TPS1_KLULA Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPS1 PE=3 SV=1 149 671 2.0E-76
sp|P31688|TPS2_YEAST Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS2 PE=1 SV=3 221 903 4.0E-76
sp|O80738|TPS10_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana GN=TPS10 PE=2 SV=1 189 898 9.0E-76
sp|Q96WK6|TPS1_ZYGRO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Zygosaccharomyces rouxii GN=TPS1 PE=2 SV=1 149 666 9.0E-75
sp|Q00075|TPSA_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger GN=tpsA PE=3 SV=1 209 673 2.0E-73
sp|O23617|TPS5_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana GN=TPS5 PE=1 SV=2 185 862 2.0E-73
sp|Q00217|TPSB_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger GN=tpsB PE=3 SV=1 171 663 3.0E-71
sp|O59921|TPS1_EMENI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpsA PE=3 SV=1 209 668 3.0E-71
sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana GN=TPS9 PE=2 SV=1 194 930 8.0E-71
sp|Q92410|TPS1_CANAL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPS1 PE=2 SV=1 171 677 5.0E-70
sp|Q94AH8|TPS6_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana GN=TPS6 PE=1 SV=2 162 862 2.0E-69
sp|Q9LMI0|TPS7_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana GN=TPS7 PE=1 SV=1 189 862 2.0E-68
sp|G4RK44|TPSP_THETK Bifunctional trehalose-6-phosphate synthase/phosphatase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=tpsp PE=1 SV=1 170 947 4.0E-68
sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana GN=TPS8 PE=2 SV=1 189 930 1.0E-65
sp|Q9ZV48|TPS11_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana GN=TPS11 PE=2 SV=1 206 862 1.0E-64
sp|Q8SSL2|TPS1_ENCCU Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Encephalitozoon cuniculi (strain GB-M1) GN=TPS1 PE=1 SV=1 169 633 2.0E-52
sp|Q93JY3|GGPS_PSEAG Glucosylglycerol-phosphate synthase OS=Pseudomonas anguilliseptica GN=ggpS PE=3 SV=2 209 666 6.0E-43
sp|A0R4M9|OTSA_MYCS2 Trehalose-phosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=otsA PE=1 SV=1 169 664 1.0E-41
sp|A0QAK7|OTSA_MYCA1 Trehalose-phosphate synthase OS=Mycobacterium avium (strain 104) GN=otsA PE=3 SV=1 169 664 1.0E-40
sp|Q743L8|OTSA_MYCPA Trehalose-phosphate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=otsA PE=3 SV=1 169 664 2.0E-40
sp|A1KPH5|OTSA_MYCBP Trehalose-phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=otsA PE=3 SV=1 169 670 2.0E-40
sp|Q7TWE1|OTSA_MYCBO Trehalose-phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=otsA PE=3 SV=1 169 670 2.0E-40
sp|Q50167|OTSA_MYCLE Trehalose-phosphate synthase OS=Mycobacterium leprae (strain TN) GN=otsA PE=3 SV=1 169 669 5.0E-40
sp|P9WN11|OTSA_MYCTU Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=otsA PE=1 SV=1 169 670 6.0E-40
sp|P9WN10|OTSA_MYCTO Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=otsA PE=3 SV=1 169 670 6.0E-40
sp|A5U8G5|OTSA_MYCTA Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=otsA PE=3 SV=1 169 670 6.0E-40
sp|Q2NTK9|OTSA_SODGM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Sodalis glossinidius (strain morsitans) GN=otsA PE=3 SV=1 156 662 2.0E-39
sp|A1TFL3|OTSA_MYCVP Trehalose-phosphate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=otsA PE=3 SV=1 169 664 9.0E-39
sp|B2HHY2|OTSA_MYCMM Trehalose-phosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=otsA PE=3 SV=1 169 664 2.0E-38
sp|A0PUT6|OTSA_MYCUA Trehalose-phosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=otsA PE=3 SV=1 169 637 3.0E-38
sp|A4T7Q6|OTSA_MYCGI Trehalose-phosphate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=otsA PE=3 SV=1 169 664 6.0E-38
sp|Q1B321|OTSA_MYCSS Trehalose-phosphate synthase OS=Mycobacterium sp. (strain MCS) GN=otsA PE=3 SV=1 166 664 3.0E-37
sp|A1UM30|OTSA_MYCSK Trehalose-phosphate synthase OS=Mycobacterium sp. (strain KMS) GN=otsA PE=3 SV=1 166 664 3.0E-37
sp|A3Q6H9|OTSA_MYCSJ Trehalose-phosphate synthase OS=Mycobacterium sp. (strain JLS) GN=otsA PE=3 SV=1 169 664 4.0E-37
sp|P74258|GGPS_SYNY3 Glucosylglycerol-phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggpS PE=1 SV=1 228 663 7.0E-37
sp|O65979|GGPS_SYNP2 Glucosylglycerol-phosphate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ggpS PE=2 SV=2 216 663 1.0E-34
sp|A9MMQ2|OTSA_SALAR Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=otsA PE=3 SV=2 190 633 3.0E-34
sp|E1WGG8|OTSA_SALTS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain SL1344) GN=otsA PE=3 SV=1 190 633 4.0E-34
sp|Q5PMW8|OTSA_SALPA Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=otsA PE=3 SV=1 190 633 4.0E-34
sp|A9MU86|OTSA_SALPB Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=otsA PE=3 SV=1 190 633 4.0E-34
sp|P0A1Q1|OTSA_SALTI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhi GN=otsA PE=3 SV=2 190 633 4.0E-34
sp|P0CL06|OTSA_SALTY Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=otsA PE=3 SV=1 190 633 4.0E-34
sp|Q57N70|OTSA_SALCH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella choleraesuis (strain SC-B67) GN=otsA PE=3 SV=1 190 633 9.0E-34
sp|A4WBR1|OTSA_ENT38 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Enterobacter sp. (strain 638) GN=otsA PE=3 SV=1 190 632 2.0E-32
sp|A8AFD4|OTSA_CITK8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=otsA PE=3 SV=2 190 681 2.0E-32
sp|Q1RAP1|OTSA_ECOUT Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain UTI89 / UPEC) GN=otsA PE=3 SV=2 224 705 7.0E-32
sp|A1AC53|OTSA_ECOK1 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O1:K1 / APEC GN=otsA PE=3 SV=2 224 705 7.0E-32
sp|Q8FGN6|OTSA_ECOL6 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=otsA PE=3 SV=2 224 705 9.0E-32
sp|Q0TGU0|OTSA_ECOL5 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=otsA PE=3 SV=1 224 705 9.0E-32
sp|Q3Z2S4|OTSA_SHISS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Shigella sonnei (strain Ss046) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|Q32H58|OTSA_SHIDS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|B1LQW0|OTSA_ECOSM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain K12) GN=otsA PE=1 SV=3 224 705 1.0E-30
sp|B1J0J4|OTSA_ECOLC Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|B1X658|OTSA_ECODH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain K12 / DH10B) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|A7ZN22|OTSA_ECO24 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=otsA PE=3 SV=1 224 705 1.0E-30
sp|A6TB47|OTSA_KLEP7 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=otsA PE=3 SV=1 190 633 1.0E-30
sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O157:H7 GN=otsA PE=3 SV=3 224 705 2.0E-30
sp|A8A1A0|OTSA_ECOHS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O9:H4 (strain HS) GN=otsA PE=3 SV=1 224 705 2.0E-30
sp|P55612|OTSA_RHISN Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Rhizobium sp. (strain NGR234) GN=otsA PE=3 SV=1 224 664 3.0E-30
sp|Q6JTB2|OTSA_PSESS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pseudomonas savastanoi GN=otsA PE=3 SV=1 224 705 7.0E-30
sp|A7MEE9|OTSA_CROS8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=otsA PE=3 SV=1 190 632 2.0E-27
sp|Q5K2C4|TPS1_APHAV Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aphelenchus avenae GN=tps-1 PE=2 SV=1 221 664 2.0E-23
sp|Q5K2C1|TPS2_APHAV Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aphelenchus avenae GN=tps-2 PE=2 SV=1 221 664 6.0E-23
sp|O45380|TPS2_CAEEL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Caenorhabditis elegans GN=tps-2 PE=2 SV=3 221 604 7.0E-21
sp|Q7YZT6|TPS1_CAEEL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Caenorhabditis elegans GN=tps-1 PE=2 SV=1 221 604 5.0E-19
sp|A8WRG3|TPS1_CAEBR Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Caenorhabditis briggsae GN=tps-1 PE=3 SV=2 221 604 1.0E-17
sp|Q8SSL0|TPP_ENCCU Probable trehalose-phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0870 PE=1 SV=1 262 368 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005992 trehalose biosynthetic process Yes
GO:0003674 molecular_function No
GO:0005991 trehalose metabolic process No
GO:0009058 biosynthetic process No
GO:0046351 disaccharide biosynthetic process No
GO:0009311 oligosaccharide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0005984 disaccharide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009312 oligosaccharide biosynthetic process No
GO:0044238 primary metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034660
MAGLRNHRVVIASLFLPTTAVLGESVPATPEIPPDGVDFLPKFSNSEKPSRVLPVHNHHSSVSGITPTIRSIVED
LQDKTRGPSPAARSPNSEAGNPFTKLTRFADVVLEHIAASDKLSNVVYSPPTCRKQISSSSAESRLQRKHSRSAS
RHPPRILKDQLWHFESNPRCNGGLKNAVESVGNKIQRKLWVGTLGTCTDNFGEAVRDDIDTRMFTEESSVPVWIP
DSEFQSCYDEFCHQVLWPALHSAVPDAPKTKMFYESASYKQYVAVNQRFADVIVSNYREGDIIWVNDYHLMLLPL
LLRSSPRIPPSAPIGFFMHIAFPSSEIFRCLSVRRDLLSGLMAADLVGFQTPNYARHFRQTVSRILAFEALPKGI
RIPEGEENHLVKVDELVRVNGLRKEVQKPGLPGSKTAEEVLKAGDEDATKSLERERFVDVGSFPMGIDVKRLQER
KQQPDVAEWVSVLRQRYAGMKIVVGRDKLDEVQGVRHKLQAFENFLERYPEFQGKVVLIQVALQTTEVNELAGGV
ADVVSRVNSRFSTLTYQPVIFLHVQDLTFSQYLALLTVGDAFIAASLREGMALRTHEFVECQEGKQNPGCLILSE
FTGSYSYTGFRSCIAINPWDTRGTADAIYKALTANAGDSKTWWMDLHNHVITQTAQTFVNNFLNRVIRAHSEHWM
DDIEDVPHLDLTRVFPQYKHSQRRLIIVDFEGTLWKRDLSRRGLQAYLNGDFEIPEEPLNALSSLAEDRRNDVWL
LSGLPVRGVLERVAEKVPNIGIVAENGCFIKIKSGRNSPYVGEWLNLVANHNLTWKSSCLEMLNYFTERTPGSII
EEREASVIWRYWTGDPREDSSDRQWARRQAAEAQNHIFDSLGERCGLRIIPGKSSFLVLPGNISRSTAVGSILQP
GGPATSSAAVRSERKGSFLESYSFNTLASPVISISNAALRVDEARSLGGEVDFVLVISSDEALLRRMNEIEGIHA
ECVTVSTSKKGTDAHWKLDLDEVEPTVPLSTNDPESGVSRGGGRVGTAVVEVLKRFAAVGDTKMVTPN*
Coding >AgabiH97|034660
ATGGCTGGCCTAAGAAACCACCGCGTTGTCATTGCCTCGCTTTTTCTCCCTACCACCGCAGTTCTGGGCGAGTCA
GTGCCCGCAACTCCCGAGATACCGCCCGACGGGGTTGATTTTCTCCCCAAGTTTTCCAACAGCGAAAAGCCGTCT
CGAGTGCTACCAGTTCATAATCACCACTCGAGTGTCTCTGGTATAACCCCAACGATTAGGAGCATTGTTGAGGAT
CTGCAGGACAAAACTCGCGGACCAAGTCCTGCAGCCCGCTCCCCTAACTCTGAAGCAGGGAACCCCTTCACAAAA
CTTACTCGCTTCGCTGACGTCGTACTTGAGCATATCGCCGCCTCAGACAAGCTATCAAATGTCGTGTATTCTCCC
CCTACCTGCCGCAAGCAAATCTCCTCCAGCAGCGCTGAATCTCGCTTGCAACGCAAACACTCTAGATCAGCGTCA
CGCCATCCCCCCCGAATCTTAAAGGATCAGCTTTGGCATTTCGAGAGCAACCCTCGCTGTAATGGCGGCCTGAAA
AATGCTGTCGAGAGTGTCGGCAATAAAATACAAAGGAAGTTGTGGGTCGGTACACTCGGAACTTGTACCGATAAT
TTTGGGGAGGCTGTGAGGGATGACATAGACACTCGGATGTTCACCGAGGAGAGCAGTGTGCCAGTTTGGATCCCC
GACTCCGAATTCCAAAGTTGCTATGACGAATTTTGTCATCAGGTACTTTGGCCAGCCCTCCATTCCGCTGTTCCC
GATGCTCCGAAGACCAAAATGTTTTATGAGTCCGCTTCCTATAAGCAATATGTTGCGGTCAATCAGCGATTTGCC
GATGTCATTGTGTCTAATTACCGGGAAGGCGACATCATCTGGGTGAATGATTACCACCTCATGCTCCTCCCTCTC
CTCCTTAGATCATCGCCGCGCATACCTCCATCTGCGCCTATTGGATTTTTTATGCATATCGCGTTCCCTTCGTCA
GAAATATTCCGTTGTCTTTCTGTTCGCCGCGATTTGCTCTCTGGTCTTATGGCTGCGGATCTTGTCGGCTTTCAA
ACACCTAATTATGCTCGCCATTTCCGCCAAACAGTTAGTCGCATTCTGGCTTTCGAGGCGTTACCAAAAGGTATT
AGAATCCCTGAAGGGGAAGAAAACCACCTTGTCAAAGTTGACGAACTCGTCCGAGTCAATGGCCTCCGCAAAGAG
GTGCAGAAGCCGGGGCTCCCTGGATCGAAAACAGCTGAGGAGGTTTTGAAGGCTGGAGATGAAGACGCTACGAAG
TCTCTCGAACGCGAGCGGTTCGTGGATGTTGGTTCTTTTCCTATGGGCATAGACGTGAAGCGCCTTCAGGAGAGG
AAACAGCAACCCGATGTGGCAGAATGGGTGTCCGTCCTGAGACAACGTTACGCTGGCATGAAGATCGTCGTGGGC
AGGGACAAGCTTGATGAAGTTCAAGGCGTTAGACACAAACTTCAGGCTTTCGAAAACTTCTTGGAGAGGTATCCT
GAGTTTCAAGGAAAGGTGGTCCTGATACAGGTCGCTCTGCAGACGACGGAGGTCAATGAATTGGCTGGTGGTGTT
GCTGATGTGGTATCGAGGGTCAACTCGCGATTTTCCACGTTGACATATCAACCCGTCATCTTCTTACATGTTCAG
GACTTGACTTTCAGTCAATATCTCGCCTTGCTTACGGTTGGCGATGCTTTCATTGCAGCTAGTCTTAGGGAAGGC
ATGGCTCTTCGGACACATGAGTTTGTCGAGTGCCAAGAAGGCAAGCAGAACCCAGGGTGCTTAATTTTGAGTGAG
TTCACTGGCTCCTACAGTTACACTGGTTTCAGGAGCTGCATTGCTATCAATCCTTGGGATACTCGAGGCACTGCA
GATGCGATATACAAAGCACTTACAGCGAATGCAGGGGATAGCAAAACTTGGTGGATGGATCTCCACAATCATGTG
ATAACCCAAACAGCCCAAACGTTCGTCAATAATTTCCTCAACCGTGTCATTCGAGCGCATTCCGAACATTGGATG
GACGACATTGAAGATGTCCCACACCTAGACCTGACCAGAGTATTCCCCCAATACAAACATTCTCAAAGACGACTT
ATCATCGTTGATTTTGAGGGCACTCTTTGGAAAAGGGACCTCAGTCGCAGAGGTCTGCAAGCCTACTTGAACGGC
GATTTTGAGATACCGGAGGAACCCCTCAATGCTTTGAGTAGTCTCGCGGAGGATAGGCGAAACGATGTTTGGTTG
CTGAGTGGCCTTCCCGTTCGCGGCGTCCTTGAACGTGTGGCTGAGAAAGTTCCCAACATTGGAATTGTCGCAGAG
AATGGGTGCTTTATCAAAATCAAATCTGGCCGAAACAGCCCTTATGTGGGAGAGTGGTTGAATCTCGTCGCGAAT
CATAACTTGACGTGGAAGAGCAGCTGTCTAGAGATGTTAAATTATTTCACGGAGCGAACGCCCGGTTCTATTATC
GAGGAAAGAGAAGCTTCCGTTATATGGCGATACTGGACTGGAGACCCACGAGAGGATTCATCTGATCGTCAGTGG
GCCCGGAGACAAGCGGCCGAAGCGCAAAACCACATCTTTGATAGCCTCGGAGAGCGTTGTGGGTTGCGTATCATA
CCAGGAAAGAGCTCCTTCCTTGTCCTTCCCGGAAACATATCTAGATCTACGGCAGTCGGCAGCATCTTACAACCG
GGAGGTCCCGCTACCTCTTCGGCTGCAGTTCGTTCGGAAAGGAAGGGTTCATTCTTAGAAAGTTATTCGTTTAAC
ACACTTGCTTCCCCGGTGATCTCCATCTCCAACGCCGCATTACGGGTTGATGAGGCTCGTAGCCTCGGCGGCGAA
GTTGATTTCGTGCTTGTTATCAGTTCTGATGAAGCTTTACTGAGGAGGATGAATGAAATAGAGGGAATCCATGCG
GAGTGTGTGACCGTCAGCACGAGCAAGAAAGGAACGGATGCCCATTGGAAACTAGACCTCGATGAAGTAGAACCG
ACCGTTCCTTTGTCAACTAACGATCCGGAATCGGGAGTTAGTAGAGGCGGTGGTAGGGTTGGCACGGCGGTTGTA
GAGGTTCTCAAACGCTTTGCGGCTGTTGGGGATACGAAGATGGTAACGCCCAACTAG
Transcript >AgabiH97|034660
ATGGCTGGCCTAAGAAACCACCGCGTTGTCATTGCCTCGCTTTTTCTCCCTACCACCGCAGTTCTGGGCGAGTCA
GTGCCCGCAACTCCCGAGATACCGCCCGACGGGGTTGATTTTCTCCCCAAGTTTTCCAACAGCGAAAAGCCGTCT
CGAGTGCTACCAGTTCATAATCACCACTCGAGTGTCTCTGGTATAACCCCAACGATTAGGAGCATTGTTGAGGAT
CTGCAGGACAAAACTCGCGGACCAAGTCCTGCAGCCCGCTCCCCTAACTCTGAAGCAGGGAACCCCTTCACAAAA
CTTACTCGCTTCGCTGACGTCGTACTTGAGCATATCGCCGCCTCAGACAAGCTATCAAATGTCGTGTATTCTCCC
CCTACCTGCCGCAAGCAAATCTCCTCCAGCAGCGCTGAATCTCGCTTGCAACGCAAACACTCTAGATCAGCGTCA
CGCCATCCCCCCCGAATCTTAAAGGATCAGCTTTGGCATTTCGAGAGCAACCCTCGCTGTAATGGCGGCCTGAAA
AATGCTGTCGAGAGTGTCGGCAATAAAATACAAAGGAAGTTGTGGGTCGGTACACTCGGAACTTGTACCGATAAT
TTTGGGGAGGCTGTGAGGGATGACATAGACACTCGGATGTTCACCGAGGAGAGCAGTGTGCCAGTTTGGATCCCC
GACTCCGAATTCCAAAGTTGCTATGACGAATTTTGTCATCAGGTACTTTGGCCAGCCCTCCATTCCGCTGTTCCC
GATGCTCCGAAGACCAAAATGTTTTATGAGTCCGCTTCCTATAAGCAATATGTTGCGGTCAATCAGCGATTTGCC
GATGTCATTGTGTCTAATTACCGGGAAGGCGACATCATCTGGGTGAATGATTACCACCTCATGCTCCTCCCTCTC
CTCCTTAGATCATCGCCGCGCATACCTCCATCTGCGCCTATTGGATTTTTTATGCATATCGCGTTCCCTTCGTCA
GAAATATTCCGTTGTCTTTCTGTTCGCCGCGATTTGCTCTCTGGTCTTATGGCTGCGGATCTTGTCGGCTTTCAA
ACACCTAATTATGCTCGCCATTTCCGCCAAACAGTTAGTCGCATTCTGGCTTTCGAGGCGTTACCAAAAGGTATT
AGAATCCCTGAAGGGGAAGAAAACCACCTTGTCAAAGTTGACGAACTCGTCCGAGTCAATGGCCTCCGCAAAGAG
GTGCAGAAGCCGGGGCTCCCTGGATCGAAAACAGCTGAGGAGGTTTTGAAGGCTGGAGATGAAGACGCTACGAAG
TCTCTCGAACGCGAGCGGTTCGTGGATGTTGGTTCTTTTCCTATGGGCATAGACGTGAAGCGCCTTCAGGAGAGG
AAACAGCAACCCGATGTGGCAGAATGGGTGTCCGTCCTGAGACAACGTTACGCTGGCATGAAGATCGTCGTGGGC
AGGGACAAGCTTGATGAAGTTCAAGGCGTTAGACACAAACTTCAGGCTTTCGAAAACTTCTTGGAGAGGTATCCT
GAGTTTCAAGGAAAGGTGGTCCTGATACAGGTCGCTCTGCAGACGACGGAGGTCAATGAATTGGCTGGTGGTGTT
GCTGATGTGGTATCGAGGGTCAACTCGCGATTTTCCACGTTGACATATCAACCCGTCATCTTCTTACATGTTCAG
GACTTGACTTTCAGTCAATATCTCGCCTTGCTTACGGTTGGCGATGCTTTCATTGCAGCTAGTCTTAGGGAAGGC
ATGGCTCTTCGGACACATGAGTTTGTCGAGTGCCAAGAAGGCAAGCAGAACCCAGGGTGCTTAATTTTGAGTGAG
TTCACTGGCTCCTACAGTTACACTGGTTTCAGGAGCTGCATTGCTATCAATCCTTGGGATACTCGAGGCACTGCA
GATGCGATATACAAAGCACTTACAGCGAATGCAGGGGATAGCAAAACTTGGTGGATGGATCTCCACAATCATGTG
ATAACCCAAACAGCCCAAACGTTCGTCAATAATTTCCTCAACCGTGTCATTCGAGCGCATTCCGAACATTGGATG
GACGACATTGAAGATGTCCCACACCTAGACCTGACCAGAGTATTCCCCCAATACAAACATTCTCAAAGACGACTT
ATCATCGTTGATTTTGAGGGCACTCTTTGGAAAAGGGACCTCAGTCGCAGAGGTCTGCAAGCCTACTTGAACGGC
GATTTTGAGATACCGGAGGAACCCCTCAATGCTTTGAGTAGTCTCGCGGAGGATAGGCGAAACGATGTTTGGTTG
CTGAGTGGCCTTCCCGTTCGCGGCGTCCTTGAACGTGTGGCTGAGAAAGTTCCCAACATTGGAATTGTCGCAGAG
AATGGGTGCTTTATCAAAATCAAATCTGGCCGAAACAGCCCTTATGTGGGAGAGTGGTTGAATCTCGTCGCGAAT
CATAACTTGACGTGGAAGAGCAGCTGTCTAGAGATGTTAAATTATTTCACGGAGCGAACGCCCGGTTCTATTATC
GAGGAAAGAGAAGCTTCCGTTATATGGCGATACTGGACTGGAGACCCACGAGAGGATTCATCTGATCGTCAGTGG
GCCCGGAGACAAGCGGCCGAAGCGCAAAACCACATCTTTGATAGCCTCGGAGAGCGTTGTGGGTTGCGTATCATA
CCAGGAAAGAGCTCCTTCCTTGTCCTTCCCGGAAACATATCTAGATCTACGGCAGTCGGCAGCATCTTACAACCG
GGAGGTCCCGCTACCTCTTCGGCTGCAGTTCGTTCGGAAAGGAAGGGTTCATTCTTAGAAAGTTATTCGTTTAAC
ACACTTGCTTCCCCGGTGATCTCCATCTCCAACGCCGCATTACGGGTTGATGAGGCTCGTAGCCTCGGCGGCGAA
GTTGATTTCGTGCTTGTTATCAGTTCTGATGAAGCTTTACTGAGGAGGATGAATGAAATAGAGGGAATCCATGCG
GAGTGTGTGACCGTCAGCACGAGCAAGAAAGGAACGGATGCCCATTGGAAACTAGACCTCGATGAAGTAGAACCG
ACCGTTCCTTTGTCAACTAACGATCCGGAATCGGGAGTTAGTAGAGGCGGTGGTAGGGTTGGCACGGCGGTTGTA
GAGGTTCTCAAACGCTTTGCGGCTGTTGGGGATACGAAGATGGTAACGCCCAACTAG
Gene >AgabiH97|034660
ATGGCTGGCCTAAGAAACCACCGCGTTGTCATTGCCTCGCTTTTTCTCCCTACCACCGCAGTTCTGGGCGAGTCA
GTGCCCGCAACTCCCGAGATACCGCCCGACGGGGTTGATTTTCTCCCCAAGTTTTCCAACAGCGAAAAGCCGTCT
CGAGTGCTACCAGTTCATAATCACCACTCGAGTGTCTCTGGTATAACCCCAACGATTAGGAGCATTGTTGAGGAT
CTGCAGGACAAAGTGCGTATCCCAGCCGTACAAGAAGGCCTCGTTGTACATAGTAATGGATGGATGTTAGACTCG
CGGACCAAGTCCTGCAGCCCGCTCCCCTAACTCTGAAGCAGGGAACCCCTTCACAAAACTTACTCGCTTCGCTGA
CGTCGTACTTGAGCATATCGCCGCCTCAGACAAGCTATCAAATGTCGTGTATTCTCCCCCTACCTGCCGCAAGCA
AATCTCCTCCAGCAGCGCTGAATCTCGCTTGCAACGCAAACACTCTAGATCAGCGTCACGCCATCCCCCCCGAAT
CTTAAAGGATCAGCTTTGGCATTTCGAGAGCAACCCTCGCTGTAATGGCGGCCTGAAAAATGCTGTCGAGAGTGT
CGGCAATAAAATACAAAGGAAGTTGTGGGTCGGTACACTCGGAACTTGTACCGATAATTTTGGGGAGGCTGTGAG
GGATGACATAGACACTCGGATGTTCACCGAGGAGAGCAGTGTGCCAGTTTGGATCCCCGACTCCGAATTCCAAAG
TTGCTATGACGAATTTTGTCATCAGGTTGAGTATATGTTCTGCCACACATTGAATATAGCTAATCTAGACCTAGG
TACTTTGGCCAGCCCTCCATTCCGCTGTTCCCGATGCTCCGAAGACCAAAATGTTTTATGAGTCCGCTTCCTATA
AGCAATATGTTGCGGTCAATCAGCGATTTGCCGATGTCATTGTGTCTAATTACCGGGAAGGCGACATCAGTGAGT
CTGACCCTCATTTCTACATCAACGAGCTCAATGGTTTGAATAGTCTGGGTGAATGATTACCACCTCATGCTCCTC
CCTCTCCTCCTTAGATCATCGCCGCGCATACCTCCATCTGCGCCTATTGGATTTTTTATGCATATCGCGTTCCCT
TCGTCAGAAATATTCCGTTGTCTTTCTGTTCGCCGCGATTTGCTCTCTGGTCTTATGGCTGCGGATCTTGTCGGC
TTTCAAACACCTAATTATGCTCGCCATTTCCGCCAAACAGTTAGTCGCATTCTGGCTTTCGAGGCGTTACCAAAA
GGTATTAGAATCCCTGAAGGGGAAGAAAACCACCTTGTCAAAGTTGACGAACTCGTCCGAGTCAATGGCCTCCGC
AAAGAGGTGCAGAAGCCGGGGCTCCCTGGATCGAAAACAGCTGAGGAGGTTTTGAAGGCTGGAGATGAAGACGCT
ACGAAGTCTCTCGAACGCGAGCGGTTCGTGGATGTTGGTTCTTTTCCTATGGGCATAGACGTGAAGCGCCTTCAG
GAGAGGAAGTAAGGTTTCTGCTATAGCATTCATAGACACAATCTGACATACACACAGACAGCAACCCGATGTGGC
AGAATGGGTGTCCGTCCTGAGACAACGTTACGCTGGCATGAAGATCGTCGTGGGCAGGGACAAGCTTGATGAAGT
TCAAGGCGTTAGACACAAACTTCAGGCTTTCGAAAACTTCTTGGAGAGGTATCCTGAGTTTCAAGGAAAGGTACA
TCATAATCAAGCAACATATCATCTGATATGCCGTACTGATTATTTATGTTTTAGGTGGTCCTGATACAGGTCGCT
CTGCAGACGACGGAGGTCAATGAATTGGCTGGTGGTGTTGCTGATGTGGTATCGAGGGTCAACTCGCGATTTTCC
ACGTTGACATATCAACCCGTCATCTTCTTACATGTATGCTTTTCAGTTTTCACAACACCGCGGCCCTAAATAACC
CCATTGACAGGTTCAGGACTTGACTTTCAGTCAATATCTCGCCTTGCTTACGGTTGGCGATGCTTTCATTGCAGC
TAGTCTTAGGGAAGGCATGGCTCTTCGGACACATGAGTTTGTCGAGTGCCAAGAAGGCAAGCAGAACCCAGGGTG
CTTAATTTTGAGTGAGGTGGGTATACTTATGTCTGCTTCCAAGAACGTAGCTAAACGTTTTATCAGTTCACTGGC
TCCTACAGTTACACTGGTTTCAGGAGCTGCATTGCTATCAATCCTTGGGATACTCGAGGCACTGCAGATGCGATA
TACAAAGCACTTACAGCGAATGCAGGGGATAGCAAAACTTGGTGGATGGTAAATCAAATGTCATCACTTACCCGT
CAAACTGACAATTCTCATTTAAGGATCTCCACAATCATGTGATAACCCAAACAGCCCAAACGTTCGTCAATAATT
TCCTCAACCGTGTCATTCGAGCGCATTCCGAACATTGGATGGACGACATTGAAGATGTCCCACACCTAGACCTGA
CCAGAGTATTCCCCCAGTGTGTACAATCCATGCTCTATATTCATCGGTGCTCATGTTCTGCTGCAGATACAAACA
TTCTCAAAGACGACTTATCATCGTTGATTTTGAGGGCACTCTTTGGAAAAGGGACCTCAGTCGCAGAGGTCTGCA
AGCCTACTTGAACGGCGATTTTGAGATACCGGAGGAACCCCTCAATGCTTTGAGTAGTCTCGCGGAGGATAGGCG
AAACGATGTTTGGTTGCTGAGTGGCCTTCCCGTTCGCGGCGTCCTTGAACGTGTGGCTGAGAAAGTTCCCAACAT
TGGAATTGTGTAAGATCATGCTGAGTATCTATTGATCATCTCTCAAGATATTATTAGCGCAGAGAATGGGTGCTT
TATCAAAATCAAATCTGGCCGAAACAGCCCTTATGTGGGAGAGTGGTTGAATCTCGTCGCGAATCATAACTTGAC
GTGGAAGAGCAGCTGTCTAGAGATGTTAAATTATGTGAGTCCATCTACTCTTAGTCCTCAACGACCTATTCATCT
ATTGCATCAGTTCACGGAGCGAACGCCCGGTTCTATTATCGAGGAAAGAGAAGCTTCCGTTATATGGCGATACTG
GACTGGAGACCCACGAGAGGATTCATCTGATCGTCAGTGGGCCCGGAGACAAGCGGCCGAAGCGCAAAACCACAT
CTTTGATAGCCTCGGAGAGCGTTGTGGGTTGCGTATCATACCAGGAAAGAGCTCCTTCCTTGTCCTTCCCGGAAA
CATATCTAGATCTACGGCAGTCGGCAGCATCTTACAACCGGGAGGTCCCGCTACCTCTTCGGCTGCAGTTCGTTC
GGAAAGGAAGGGTTCATTCTTAGAAAGTTATTCGTTTAACACACTTGCTTCCCCGGTGATCTCCATCTCCAACGC
CGCATTACGGGTTGATGAGGCTCGTAGCCTCGGCGGCGAAGTTGATTTCGTGCTTGTTATCAGTTCTGATGAAGC
TTTACTGAGGAGGATGAATGAAATAGAGGGAATCCATGCGGAGTGTGTGACCGTCAGCACGAGCAAGAAAGGAAC
GGATGCCCATTGGAAACTAGACCTCGATGAAGTAGAACCGACCGTTCCTTTGTCAACTAACGATCCGGAATCGGG
AGTTAGTAGAGGCGGTGGTAGGGTTGGCACGGCGGTTGTAGAGGTTCTCAAACGCTTTGCGGCTGTTGGGGATAC
GAAGATGGTAACGCCCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail