Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034590
Gene name
Locationscaffold_13:263245..265803
Strand+
Gene length (bp)2558
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17389 Bac_rhamnosid6H Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain 2.7E-19 243 459
PF01204 Trehalase Trehalase 7.0E-05 374 445

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004555 alpha,alpha-trehalase activity Yes
GO:0005991 trehalose metabolic process Yes
GO:0044262 cellular carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0015927 trehalase activity No
GO:0044237 cellular metabolic process No
GO:0016787 hydrolase activity No
GO:0005984 disaccharide metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034590
MIFLASLLFYAGLGRCLAPSGEWDKFNFAPSSRIVTAVAIHSSHGQITNPENLVEARGKTTFSSSGSWLALDFGI
EVGGLISLNIDSAPAGSALALSFTESSQFIRPTSSDDSSFPSENTTYDGILQVQTPLKTGLWEQPSASLRGGFRY
LTLVSNSKSPLTLSNVTCTISFMPHFQDLRAYTGYFSAKHPTFHDEDFLTKLWYAGGYTVQTNTVPLNTGRQVPF
AHAGTWANNAVLGVAGPIIVDGAKRDRAVWPGDMGIAVPTQFVSTNDLISTRNALATMFAHINPNGALPESGPPL
SQQGSDTYHAWTLIGTHNYHHLTGDKEWVQSVWSNFTRAVTFLEQKVDETGLIDITGLRDWARLGGGGHNSEGNA
LFYEVLVTASDLAAQLDEIQQANRWSSKAISLKQRFNDAFWDEDAGQYKDNLTTTLHPQDANSLAVVFNLTDSQE
KNRRISEGLQTNWNDLGPVPPELPDTISPFISGFELQAHFIAGEDKRAMDLLERTWGYMLYTNISVQSTLLEGFT
ANGSLSYRYYRGYNNDPAYTSHSHGWSSGPTSTLTFYLLGLTVTSTRGQTWSFAPHLGTGVPAAEGGFETPLGRY
DAAWSFDKDANGNDVFNIRIMTPQGTQGIVKLPSNMMASYVRDGETKNVVLGGPAEMEVTGGRHDISWNIVTPLV
E*
Coding >AgabiH97|034590
ATGATATTTCTTGCATCTCTTCTTTTCTACGCTGGCCTAGGTCGCTGCTTGGCACCTTCCGGGGAGTGGGACAAA
TTCAACTTTGCCCCATCTTCTAGAATTGTGACCGCAGTAGCTATCCATTCTTCTCATGGTCAGATCACAAACCCG
GAGAACCTCGTTGAGGCGCGTGGAAAGACTACGTTTTCGTCGTCCGGCAGCTGGCTGGCGCTGGACTTCGGTATC
GAAGTTGGAGGTTTAATTTCGTTGAACATTGATTCGGCTCCCGCTGGTTCAGCCCTCGCACTTTCATTCACCGAG
TCGTCCCAATTCATTCGCCCAACCTCTTCCGATGATTCATCATTCCCTTCGGAAAATACCACATACGACGGAATA
TTACAGGTTCAAACACCTTTAAAAACTGGATTATGGGAACAACCCTCAGCTAGTCTTCGTGGAGGATTTCGCTAC
CTGACTCTCGTCTCAAACTCAAAATCGCCTTTGACTTTGTCTAATGTGACTTGCACCATCTCTTTCATGCCTCAT
TTCCAAGATCTCCGAGCCTATACCGGTTATTTCTCTGCCAAACATCCAACGTTTCACGATGAAGATTTTTTGACT
AAGCTCTGGTACGCAGGCGGCTATACCGTTCAGACCAATACAGTCCCATTGAATACGGGACGACAAGTACCTTTT
GCACATGCAGGGACTTGGGCGAATAATGCTGTTCTCGGCGTAGCAGGACCTATCATTGTAGATGGTGCCAAGCGT
GATCGAGCTGTTTGGCCCGGCGATATGGGGATTGCTGTCCCAACTCAATTCGTCTCCACCAACGACCTTATTTCA
ACACGAAATGCTTTGGCTACCATGTTCGCCCATATCAATCCTAACGGTGCATTGCCCGAATCGGGTCCTCCGCTC
AGTCAACAAGGTTCCGATACATATCATGCATGGACACTCATTGGGACTCATAATTACCATCATTTGACTGGAGAT
AAGGAATGGGTGCAATCGGTTTGGTCCAATTTCACAAGAGCTGTGACTTTTCTAGAACAAAAGGTTGACGAGACC
GGGCTTATCGATATTACTGGCTTGCGTGATTGGGCAAGATTAGGTGGAGGTGGTCATAATTCTGAAGGAAATGCG
CTATTCTACGAGGTTCTTGTTACAGCTTCTGATCTCGCCGCTCAACTAGATGAGATTCAACAAGCCAATCGATGG
TCTTCCAAAGCGATATCACTGAAACAGAGGTTCAACGATGCGTTTTGGGATGAAGATGCTGGGCAATACAAAGAC
AACCTTACTACGACTTTACATCCACAAGATGCAAATTCGCTTGCTGTCGTTTTCAATCTTACAGATTCGCAAGAA
AAGAATCGAAGGATTAGTGAAGGATTACAAACGAATTGGAATGATCTTGGTCCTGTGCCTCCTGAACTTCCAGAT
ACGATTAGTCCTTTCATCAGTGGCTTTGAATTACAAGCACATTTTATTGCCGGAGAAGACAAACGTGCGATGGAC
CTTCTTGAGAGAACTTGGGGATACATGTTATATACCAATATCTCAGTCCAAAGCACACTCCTCGAAGGTTTTACC
GCGAATGGATCATTGAGTTATCGATATTATCGCGGGTACAACAACGATCCTGCTTATACATCTCATAGTCATGGA
TGGAGTTCCGGACCCACATCAACTCTAACGTTTTATCTTCTGGGATTGACAGTAACATCAACCCGGGGACAGACT
TGGAGTTTCGCTCCGCATCTTGGTACCGGTGTTCCCGCAGCTGAAGGAGGTTTTGAAACGCCACTAGGACGATAT
GACGCGGCATGGTCTTTTGATAAAGACGCCAATGGCAATGATGTCTTCAATATTCGTATAATGACTCCACAAGGA
ACACAAGGTATAGTTAAATTGCCCAGTAATATGATGGCAAGTTATGTTCGAGATGGGGAAACGAAAAATGTTGTA
CTGGGTGGGCCAGCTGAGATGGAGGTGACTGGAGGGAGACATGATATTTCTTGGAACATTGTTACACCTCTTGTT
GAATGA
Transcript >AgabiH97|034590
ATGATATTTCTTGCATCTCTTCTTTTCTACGCTGGCCTAGGTCGCTGCTTGGCACCTTCCGGGGAGTGGGACAAA
TTCAACTTTGCCCCATCTTCTAGAATTGTGACCGCAGTAGCTATCCATTCTTCTCATGGTCAGATCACAAACCCG
GAGAACCTCGTTGAGGCGCGTGGAAAGACTACGTTTTCGTCGTCCGGCAGCTGGCTGGCGCTGGACTTCGGTATC
GAAGTTGGAGGTTTAATTTCGTTGAACATTGATTCGGCTCCCGCTGGTTCAGCCCTCGCACTTTCATTCACCGAG
TCGTCCCAATTCATTCGCCCAACCTCTTCCGATGATTCATCATTCCCTTCGGAAAATACCACATACGACGGAATA
TTACAGGTTCAAACACCTTTAAAAACTGGATTATGGGAACAACCCTCAGCTAGTCTTCGTGGAGGATTTCGCTAC
CTGACTCTCGTCTCAAACTCAAAATCGCCTTTGACTTTGTCTAATGTGACTTGCACCATCTCTTTCATGCCTCAT
TTCCAAGATCTCCGAGCCTATACCGGTTATTTCTCTGCCAAACATCCAACGTTTCACGATGAAGATTTTTTGACT
AAGCTCTGGTACGCAGGCGGCTATACCGTTCAGACCAATACAGTCCCATTGAATACGGGACGACAAGTACCTTTT
GCACATGCAGGGACTTGGGCGAATAATGCTGTTCTCGGCGTAGCAGGACCTATCATTGTAGATGGTGCCAAGCGT
GATCGAGCTGTTTGGCCCGGCGATATGGGGATTGCTGTCCCAACTCAATTCGTCTCCACCAACGACCTTATTTCA
ACACGAAATGCTTTGGCTACCATGTTCGCCCATATCAATCCTAACGGTGCATTGCCCGAATCGGGTCCTCCGCTC
AGTCAACAAGGTTCCGATACATATCATGCATGGACACTCATTGGGACTCATAATTACCATCATTTGACTGGAGAT
AAGGAATGGGTGCAATCGGTTTGGTCCAATTTCACAAGAGCTGTGACTTTTCTAGAACAAAAGGTTGACGAGACC
GGGCTTATCGATATTACTGGCTTGCGTGATTGGGCAAGATTAGGTGGAGGTGGTCATAATTCTGAAGGAAATGCG
CTATTCTACGAGGTTCTTGTTACAGCTTCTGATCTCGCCGCTCAACTAGATGAGATTCAACAAGCCAATCGATGG
TCTTCCAAAGCGATATCACTGAAACAGAGGTTCAACGATGCGTTTTGGGATGAAGATGCTGGGCAATACAAAGAC
AACCTTACTACGACTTTACATCCACAAGATGCAAATTCGCTTGCTGTCGTTTTCAATCTTACAGATTCGCAAGAA
AAGAATCGAAGGATTAGTGAAGGATTACAAACGAATTGGAATGATCTTGGTCCTGTGCCTCCTGAACTTCCAGAT
ACGATTAGTCCTTTCATCAGTGGCTTTGAATTACAAGCACATTTTATTGCCGGAGAAGACAAACGTGCGATGGAC
CTTCTTGAGAGAACTTGGGGATACATGTTATATACCAATATCTCAGTCCAAAGCACACTCCTCGAAGGTTTTACC
GCGAATGGATCATTGAGTTATCGATATTATCGCGGGTACAACAACGATCCTGCTTATACATCTCATAGTCATGGA
TGGAGTTCCGGACCCACATCAACTCTAACGTTTTATCTTCTGGGATTGACAGTAACATCAACCCGGGGACAGACT
TGGAGTTTCGCTCCGCATCTTGGTACCGGTGTTCCCGCAGCTGAAGGAGGTTTTGAAACGCCACTAGGACGATAT
GACGCGGCATGGTCTTTTGATAAAGACGCCAATGGCAATGATGTCTTCAATATTCGTATAATGACTCCACAAGGA
ACACAAGGTATAGTTAAATTGCCCAGTAATATGATGGCAAGTTATGTTCGAGATGGGGAAACGAAAAATGTTGTA
CTGGGTGGGCCAGCTGAGATGGAGGTGACTGGAGGGAGACATGATATTTCTTGGAACATTGTTACACCTCTTGTT
GAATGA
Gene >AgabiH97|034590
ATGATATTTCTTGCATCTCTTCTTTTCTACGCTGGCCTAGGTCGCTGCTTGGCACCTTCCGGGGAGTGGGACAAA
TTCAACTTTGCCCCATCTTCTAGAATTGTGACCGCAGTAGCTATCCATTCTTCTCATGGTCAGATCACAAACCCG
GAGAACCTCGTTGAGGCGCGTGGAAAGACTACGTTTTCGTCGTCCGGCAGCTGGCTGGCGCTGGACTTCGGTATC
GAAGTACGTGCATGAACATGATGTTTACGTGGTTATTGGCAAGAATTGAAACTCTTTCATACAGGTTGGAGGTTT
AATTTCGTTGAACATTGATTCGGCTCCCGCTGGTTCAGCCCTCGCACTTTCATTCACCGAGTCGTCCCAATTCAT
TCGCCCAACCTCTTCCGATGATTCATCATTCCCTTCGGAAAATACCACATACGACGGAATATTACAGGTTCAAAC
ACCTTTAAAAACTGGATTATGGGAACAACCCTCAGCTAGTCTTCGTGGAGGATTTCGCTACCTGACTCTCGTCTC
AAACTCAAAATCGCCTTTGACTTTGTCTAATGTGACTTGCACCATCTCTTTCATGCCTCATTTCCAAGATCTCCG
AGCCTATACCGGTTATTTCTCTGCCAAACATCCAACGTTTCACGATGAAGATTTTTTGACTAAGCGTTAGATTTA
TCATCCCATCCGTGAAACATTTCTGTTGACGTGGCGTTCATTATTTCAGTCTGGTACGCAGGCGGCTATACCGTT
CAGACCAATACAGTCCCATTGAATACGGGACGACAAGTACCTTTTGCACATGCAGGGAGTGAGTCTGCTTATCAT
TAGCGCATTTACGGCTCAGATTTATTTTTTACCATCTTTCATCCACAGCTTGGGCGAATAATGCTGTTCTCGGCG
TAGCAGGACCTATCATTGTAGATGGTGCCAAGCGTGATCGGTAAGGCAAACAATACTTGTCCTCGTCACTCTCGG
CATGACACTCGAATTTTACAGAGCTGTTTGGCCCGGTTAGCGGTTAAATCCTCGAATCAAAATGATGTACTGAAT
TGAACCCCTGTAGGCGATATGGGGATTGCTGTCCCAACTCAATTCGTCTCCACCAACGACCTTATTTCAACACGA
AATGCTTTGGCTACCATGTTCGCCCATATCAATCCTAACGGTGCATTGCCCGAATCGGGTCCTCCGCTCAGTCAA
CAAGGTTCCGATACATATCATGCATGGACACTCATTGGGACTCGTTAGTTCTTTTTACGGCTTGTTCAACATAGA
GATCTCTAACTTGAACGCTGTCAGATAATTACCATCATTTGACTGGAGATAAGGAATGGGTGCAATCGGTTTGGT
CCAATTTCACAAGAGCTGTGACTTTTCTAGAACAAAAGGTTGACGAGACCGGGCTTATCGATATTACTGGCTTGC
GTGATTGGGCAAGATTAGGTGGAGGTGGTCATAATTCTGAAGGAAATGCGCTATTCTACGAGGTACTATTTTTTT
CGTTCAAACGTCAAATTCGCGATCAACGCCGTATACTATGTGTTACTAGGTTCTTGTTACAGCTTCTGATCTCGC
CGCTCAACTAGATGAGATTCAACAAGCCAATCGATGGTCTTCCAAAGCGATATCACTGAAACAGAGGTTCAACGA
TGCGTTTTGGGATGAAGATGCTGGGCAATACAAAGACAACCTTACTACGACTTTACATCCACAAGATGCAAATTC
GCTTGCTGTCGTTTTCAATCTTACAGATTCGCAAGAAAAGAATCGAAGGATTAGTGAAGGATTACAAACGAATTG
GAATGATCTTGGTCCTGTGCCTCCTGAACTTCCAGATACGATTAGTCCTTTCATCAGTGGCTTTGAAGTAAGAGT
TCTTTTTAAAGTTCATTAATCATTTATGAACTCCCTTTTAGTTACAAGCACATTTTATTGCCGGAGAAGACAAAC
GTGCGATGGACCTTCTTGAGAGAACTTGGGGATACATGTTATATACCAATATCTCAGTCCAAAGCACACTCCTCG
AAGGTTTTACCGCGAATGGATCATTGAGGTACACCCCAAAATAAAAAAATTGTATCCTCGTATTTTGCGTCTCAA
AATATTTTTTTCTCCACAGTTATCGATATTATCGCGGGTACAACAACGATCCTGCTTATACATCTCATAGTCATG
GATGGAGTTCCGGACCCACATCAACTCTAACGTTTTATCTTCTGGGATTGACAGTAACATCAACCCGGGGACAGA
CTTGGAGTTTCGCTCCGCATCTTGGTACCGGTGTTCCCGCAGCTGAAGGAGGTTTTGAAACGCCACTAGGACGAT
ATGACGCGGCATGGTCTTTTGATAAAGACGCCAATGGCAATGATGTCTTCAATATTCGTATAATGACTCCACAAG
GAACACAAGGTATAGTTAAATTGCCCAGTAATATGATGGCAAGTTATGTTCGAGATGGGGAAACGAAAAATGTTG
TACTGGGTGGGCCAGCTGAGATGGAGGTGACTGGAGGGAGACATGATATTTCTTGGAACATTGTTACACCTCTTG
TTGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail