Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034550
Gene name
Locationscaffold_13:254246..257854
Strand+
Gene length (bp)3608
Transcript length (bp)3090
Coding sequence length (bp)3090
Protein length (aa) 1030

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07774 EMC1_C ER membrane protein complex subunit 1, C-terminal 7.8E-74 812 1027
PF13360 PQQ_2 PQQ-like domain 4.6E-06 47 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 20 1027 8.0E-58
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 414 1027 9.0E-53
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 414 1027 1.0E-52
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 414 1027 3.0E-52
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 399 1027 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 20 1027 8.0E-58
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 414 1027 9.0E-53
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 414 1027 1.0E-52
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 414 1027 3.0E-52
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 399 1027 3.0E-49
sp|O13981|EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emc1 PE=3 SV=1 707 1028 1.0E-43
sp|P25574|EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC1 PE=1 SV=1 707 1027 8.0E-26
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 19 119 5.0E-06
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 17 119 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 999 1018 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034550
MRQLFFVFLLVLQSCLVHAVHKSDVGLIDWYKQLVGVPLTTTANSPTFHHVGGRDIILTATMSNVLAALDAADGQ
VAWRYIFEGEDMIAGYYAHDNVVVTLSGTGGEILRTFDIQTGVLLLEKQLHPPQLGHRAEPHTLGKHVVFGDNNS
TDIYVLTNGYNFAHMNRETGETYWEFASPDASSLVIHSKLVLTPSALYLIGIAKSLQSYTLHVTSLNPKTGELIT
TANIPSSIENPINGFQVLSNGISDNNRIVWLEHGTLKHVLLVPKLNSKPVSVQQAEFESFVDVGLSKDAHIVAIK
TDGAARVIKLIEDGIKGVYDFKDEATTNEEQRFPVYSGNVEETGRVHVARVYWKQDVKQVALEIYSGTPDLSFSL
FDFDTLNNGVINFAALNARGTGSNDVAPRLLISTYTGNVQLVEGTQVKWNREEALTSSVVAEFAELPPPKAVVGD
HEGESFVSRVIRHVADLQKLPAYILHFLKRFVMNQSSLLTTKNNIQSDEAVRDEFGFRQIIVVATMFGKVYGIDS
ATGNVVWTRLLGLGWAANGGARLAPLKLYTFNGEGVGGEGKGTRSDVVLIVQRTAANTLVDTVLFHIDAATGQDL
TGKTAGSDVLEGIDIVPGVMVESYMLQLKGQKLVMLLDEYLQTYTYPDTPEAYDLLKEVASSLYFPLRTNSKSPS
PPGSPRQRHLVGYQVGMNDELSKDRLIAHPVWTLSFRDGETVVGLVSPQKGPVASYGKVMANRTTLYKYLNPHMN
VVLTDQRQGRPVTRDTNATTPTTEHPGCGVYVVDNVKGSILYEASLPSPGPGMKCNVKATLTENWLAYHYYDPEE
AAVEEARGWRLVTVEFYEGDIDKKTKSSEASSFSEASTQVQIFEDVFVFPQGITAMTMTKTKFGISTKDLIVATN
SNKIQSYPRRLLDPRRPRRKPTNQELEEGLMQYEPVLFDHPKSVLSHEYDVARTQHIITAPSLLESTSLVFATGL
DMFLTRTSPSGTFDLLSETFNKKQLIWTVGGLLVALLVAWPMVREKKLNGKWYF*
Coding >AgabiH97|034550
ATGCGGCAGCTGTTCTTTGTTTTCCTGCTCGTCCTACAGTCCTGTCTCGTCCATGCCGTCCACAAGTCCGATGTC
GGCCTCATTGATTGGTACAAACAACTCGTCGGCGTGCCTCTGACCACGACAGCCAATTCACCTACCTTTCACCAT
GTCGGCGGACGAGATATTATCCTAACAGCAACAATGAGCAACGTGTTGGCAGCGCTAGATGCAGCGGACGGACAA
GTTGCGTGGCGGTACATCTTCGAGGGCGAGGATATGATTGCTGGTTACTATGCTCATGACAATGTTGTCGTAACA
TTATCTGGAACCGGCGGCGAAATCTTGCGGACATTCGACATACAGACGGGAGTTCTCTTACTCGAGAAACAACTC
CATCCCCCGCAACTCGGTCATCGGGCCGAACCTCATACCCTTGGAAAACATGTTGTGTTTGGCGACAACAACAGC
ACGGATATCTACGTTCTGACGAACGGGTACAACTTTGCTCACATGAATCGCGAAACTGGAGAAACCTATTGGGAG
TTTGCCTCGCCTGATGCCAGCTCATTAGTGATTCATTCAAAGCTTGTCTTGACGCCCTCCGCCCTTTATCTTATT
GGCATTGCCAAGTCATTGCAGTCCTATACCCTCCATGTCACGTCTTTGAATCCAAAGACCGGTGAATTAATCACT
ACCGCAAACATTCCCTCCAGTATCGAGAACCCAATAAACGGATTTCAAGTACTCTCTAACGGTATTTCGGACAAT
AATCGAATCGTTTGGTTAGAGCATGGCACTCTCAAACACGTCCTTCTCGTACCCAAATTGAATTCAAAACCGGTT
TCTGTGCAACAAGCAGAATTCGAATCCTTCGTCGATGTTGGTCTTTCAAAGGACGCGCACATAGTTGCTATCAAA
ACCGATGGTGCTGCTCGTGTCATCAAGTTGATTGAGGATGGTATAAAGGGAGTATATGACTTTAAGGATGAGGCC
ACCACGAACGAGGAACAACGATTTCCTGTATATTCAGGCAATGTAGAAGAGACCGGGCGCGTTCATGTTGCGAGG
GTCTACTGGAAACAAGATGTCAAGCAAGTCGCCCTGGAAATTTATTCAGGAACGCCAGACTTGAGCTTTAGCTTG
TTCGATTTTGACACTCTCAACAATGGAGTTATCAACTTCGCTGCTTTGAACGCTCGAGGCACTGGTTCAAATGAC
GTTGCTCCTAGGCTCCTCATCTCGACGTATACTGGCAATGTTCAACTGGTTGAAGGCACACAAGTGAAATGGAAT
AGGGAAGAAGCTTTGACCAGTTCTGTTGTTGCCGAATTTGCCGAGCTACCACCACCAAAAGCGGTGGTGGGTGAC
CATGAAGGCGAGTCGTTTGTGAGTCGAGTGATCCGTCACGTTGCAGACCTTCAGAAATTACCCGCATATATTCTC
CATTTTCTGAAGCGGTTTGTCATGAATCAATCATCCCTTCTAACCACAAAGAACAACATTCAGTCTGATGAAGCT
GTTCGGGATGAGTTCGGCTTTAGACAAATCATTGTGGTGGCCACTATGTTTGGAAAAGTGTATGGCATTGATTCG
GCAACGGGAAATGTCGTCTGGACGAGGTTACTTGGTTTAGGATGGGCCGCCAACGGCGGTGCACGTCTTGCCCCT
TTGAAACTCTATACATTCAATGGGGAGGGTGTTGGTGGAGAGGGCAAGGGCACGAGGTCTGATGTTGTCTTGATT
GTCCAGAGGACAGCGGCTAATACGTTGGTTGATACGGTGTTGTTCCACATCGATGCAGCGACAGGACAAGACCTT
ACAGGTAAAACCGCCGGGAGTGATGTGCTTGAGGGCATAGATATCGTACCTGGAGTTATGGTGGAGTCATATATG
CTACAACTCAAAGGGCAGAAATTGGTGATGCTCCTTGACGAATATCTTCAGACCTATACATACCCCGACACCCCA
GAAGCTTACGACCTGCTAAAAGAGGTTGCTTCTTCATTGTACTTCCCCTTACGCACCAACTCAAAATCGCCTTCT
CCACCTGGTTCTCCCAGGCAACGTCATCTCGTTGGTTACCAGGTTGGTATGAATGACGAGCTAAGCAAGGACCGT
CTGATAGCTCATCCTGTATGGACGTTATCATTCCGAGATGGTGAAACTGTCGTTGGCCTAGTCAGTCCTCAAAAA
GGTCCCGTTGCTAGTTATGGCAAAGTTATGGCAAATCGGACGACGTTGTATAAATACTTGAATCCACATATGAAT
GTGGTTTTGACCGATCAACGACAAGGACGGCCAGTGACGAGGGACACGAATGCGACGACACCTACTACGGAGCAC
CCGGGTTGTGGGGTTTATGTGGTAGATAACGTGAAGGGTTCTATTCTATATGAAGCGTCGTTACCTTCACCGGGT
CCTGGGATGAAGTGCAATGTCAAGGCTACATTGACTGAAAACTGGTTGGCGTATCATTATTATGATCCGGAGGAG
GCTGCTGTTGAGGAAGCGAGAGGTTGGAGATTAGTTACTGTTGAGTTCTATGAGGGTGATATCGATAAAAAGACC
AAGAGTTCCGAAGCGTCTAGTTTCTCGGAAGCTAGTACGCAAGTACAGATATTTGAAGATGTTTTTGTATTCCCG
CAAGGAATCACTGCAATGACAATGACTAAGACCAAGTTTGGTATCTCTACAAAAGACTTGATTGTTGCAACGAAC
AGCAATAAGATTCAGTCATACCCTAGAAGACTTCTCGACCCTCGTCGACCACGCCGAAAACCTACAAATCAAGAA
CTCGAAGAAGGATTAATGCAATATGAGCCCGTCTTGTTCGACCATCCCAAATCCGTCCTTTCACATGAATACGAC
GTAGCGCGTACTCAACATATCATCACAGCTCCCTCACTTCTCGAATCCACTTCACTCGTGTTCGCAACTGGTTTA
GATATGTTCCTTACACGGACATCACCGTCTGGGACGTTTGATTTGCTGAGTGAGACGTTTAATAAGAAGCAGTTG
ATATGGACTGTTGGGGGGCTGTTGGTGGCGCTTTTGGTAGCGTGGCCGATGGTGAGGGAGAAAAAATTGAATGGG
AAATGGTATTTCTAG
Transcript >AgabiH97|034550
ATGCGGCAGCTGTTCTTTGTTTTCCTGCTCGTCCTACAGTCCTGTCTCGTCCATGCCGTCCACAAGTCCGATGTC
GGCCTCATTGATTGGTACAAACAACTCGTCGGCGTGCCTCTGACCACGACAGCCAATTCACCTACCTTTCACCAT
GTCGGCGGACGAGATATTATCCTAACAGCAACAATGAGCAACGTGTTGGCAGCGCTAGATGCAGCGGACGGACAA
GTTGCGTGGCGGTACATCTTCGAGGGCGAGGATATGATTGCTGGTTACTATGCTCATGACAATGTTGTCGTAACA
TTATCTGGAACCGGCGGCGAAATCTTGCGGACATTCGACATACAGACGGGAGTTCTCTTACTCGAGAAACAACTC
CATCCCCCGCAACTCGGTCATCGGGCCGAACCTCATACCCTTGGAAAACATGTTGTGTTTGGCGACAACAACAGC
ACGGATATCTACGTTCTGACGAACGGGTACAACTTTGCTCACATGAATCGCGAAACTGGAGAAACCTATTGGGAG
TTTGCCTCGCCTGATGCCAGCTCATTAGTGATTCATTCAAAGCTTGTCTTGACGCCCTCCGCCCTTTATCTTATT
GGCATTGCCAAGTCATTGCAGTCCTATACCCTCCATGTCACGTCTTTGAATCCAAAGACCGGTGAATTAATCACT
ACCGCAAACATTCCCTCCAGTATCGAGAACCCAATAAACGGATTTCAAGTACTCTCTAACGGTATTTCGGACAAT
AATCGAATCGTTTGGTTAGAGCATGGCACTCTCAAACACGTCCTTCTCGTACCCAAATTGAATTCAAAACCGGTT
TCTGTGCAACAAGCAGAATTCGAATCCTTCGTCGATGTTGGTCTTTCAAAGGACGCGCACATAGTTGCTATCAAA
ACCGATGGTGCTGCTCGTGTCATCAAGTTGATTGAGGATGGTATAAAGGGAGTATATGACTTTAAGGATGAGGCC
ACCACGAACGAGGAACAACGATTTCCTGTATATTCAGGCAATGTAGAAGAGACCGGGCGCGTTCATGTTGCGAGG
GTCTACTGGAAACAAGATGTCAAGCAAGTCGCCCTGGAAATTTATTCAGGAACGCCAGACTTGAGCTTTAGCTTG
TTCGATTTTGACACTCTCAACAATGGAGTTATCAACTTCGCTGCTTTGAACGCTCGAGGCACTGGTTCAAATGAC
GTTGCTCCTAGGCTCCTCATCTCGACGTATACTGGCAATGTTCAACTGGTTGAAGGCACACAAGTGAAATGGAAT
AGGGAAGAAGCTTTGACCAGTTCTGTTGTTGCCGAATTTGCCGAGCTACCACCACCAAAAGCGGTGGTGGGTGAC
CATGAAGGCGAGTCGTTTGTGAGTCGAGTGATCCGTCACGTTGCAGACCTTCAGAAATTACCCGCATATATTCTC
CATTTTCTGAAGCGGTTTGTCATGAATCAATCATCCCTTCTAACCACAAAGAACAACATTCAGTCTGATGAAGCT
GTTCGGGATGAGTTCGGCTTTAGACAAATCATTGTGGTGGCCACTATGTTTGGAAAAGTGTATGGCATTGATTCG
GCAACGGGAAATGTCGTCTGGACGAGGTTACTTGGTTTAGGATGGGCCGCCAACGGCGGTGCACGTCTTGCCCCT
TTGAAACTCTATACATTCAATGGGGAGGGTGTTGGTGGAGAGGGCAAGGGCACGAGGTCTGATGTTGTCTTGATT
GTCCAGAGGACAGCGGCTAATACGTTGGTTGATACGGTGTTGTTCCACATCGATGCAGCGACAGGACAAGACCTT
ACAGGTAAAACCGCCGGGAGTGATGTGCTTGAGGGCATAGATATCGTACCTGGAGTTATGGTGGAGTCATATATG
CTACAACTCAAAGGGCAGAAATTGGTGATGCTCCTTGACGAATATCTTCAGACCTATACATACCCCGACACCCCA
GAAGCTTACGACCTGCTAAAAGAGGTTGCTTCTTCATTGTACTTCCCCTTACGCACCAACTCAAAATCGCCTTCT
CCACCTGGTTCTCCCAGGCAACGTCATCTCGTTGGTTACCAGGTTGGTATGAATGACGAGCTAAGCAAGGACCGT
CTGATAGCTCATCCTGTATGGACGTTATCATTCCGAGATGGTGAAACTGTCGTTGGCCTAGTCAGTCCTCAAAAA
GGTCCCGTTGCTAGTTATGGCAAAGTTATGGCAAATCGGACGACGTTGTATAAATACTTGAATCCACATATGAAT
GTGGTTTTGACCGATCAACGACAAGGACGGCCAGTGACGAGGGACACGAATGCGACGACACCTACTACGGAGCAC
CCGGGTTGTGGGGTTTATGTGGTAGATAACGTGAAGGGTTCTATTCTATATGAAGCGTCGTTACCTTCACCGGGT
CCTGGGATGAAGTGCAATGTCAAGGCTACATTGACTGAAAACTGGTTGGCGTATCATTATTATGATCCGGAGGAG
GCTGCTGTTGAGGAAGCGAGAGGTTGGAGATTAGTTACTGTTGAGTTCTATGAGGGTGATATCGATAAAAAGACC
AAGAGTTCCGAAGCGTCTAGTTTCTCGGAAGCTAGTACGCAAGTACAGATATTTGAAGATGTTTTTGTATTCCCG
CAAGGAATCACTGCAATGACAATGACTAAGACCAAGTTTGGTATCTCTACAAAAGACTTGATTGTTGCAACGAAC
AGCAATAAGATTCAGTCATACCCTAGAAGACTTCTCGACCCTCGTCGACCACGCCGAAAACCTACAAATCAAGAA
CTCGAAGAAGGATTAATGCAATATGAGCCCGTCTTGTTCGACCATCCCAAATCCGTCCTTTCACATGAATACGAC
GTAGCGCGTACTCAACATATCATCACAGCTCCCTCACTTCTCGAATCCACTTCACTCGTGTTCGCAACTGGTTTA
GATATGTTCCTTACACGGACATCACCGTCTGGGACGTTTGATTTGCTGAGTGAGACGTTTAATAAGAAGCAGTTG
ATATGGACTGTTGGGGGGCTGTTGGTGGCGCTTTTGGTAGCGTGGCCGATGGTGAGGGAGAAAAAATTGAATGGG
AAATGGTATTTCTAG
Gene >AgabiH97|034550
ATGCGGCAGCTGTTCTTTGTTTTCCTGCTCGTCCTACAGTCCTGTCTCGTCCATGCCGTCCACAAGTCCGATGTC
GGCCTCATTGATTGGTACAAACAACTCGTCGGCGTGCCTCTGACCACGACAGCCAATTCACCTACCTTTCACCAT
GTCGGCGGACGAGATATTATCCTAACAGCAACAATGAGCAACGTGTTGGCAGCGCTAGATGCAGCGGACGGACAA
GTTGGTGAGTACGCCGACTTTATTAGGGTGCTGTTGTAACCCGTCCCTTTGTGTAGCGTGGCGGTACATCTTCGA
GGGCGAGGATATGATTGCTGGTTACTATGCTCATGACAATGGTAGGCTCTGCCATTCGTTTCTTCAAGGCACATC
TTATGCTAATTCACTTAGTTGTCGTAACATTATCTGGAACCGGCGGCGAAATCTTGCGGACATTCGACATACAGA
CGGGAGTTCTCTTACTCGAGAAACAACTCCATCCCCCGCAACTCGGTCATCGGGCCGAACCTCATACCCTTGGAA
AACATGTTGTGTTTGGCGACAACAACAGCACGGATATCTACGTTCTGACGAACGGGTACAACTTTGCTCACATGA
ATCGCGAAACTGGAGAAACCTATTGGGAGTTTGCCTCGCCTGATGCCAGGTTCGCCATCCACGCCGACTGTTTTA
CACTATGCTGAATGACCCTAGCTCATTAGTGATTCATTCAAAGCTTGTCTTGACGCCCTCCGCCCTTTATCTTAT
TGGCATTGCCAAGTCATTGCAGTCCTATACCCTCCATGTCACGTCTTTGAATCCAAAGACCGGTGAATTAATCAC
TACCGCAAACATTCCCTCCAGTATCGAGAACCCAATAAACGGATTTCAAGTACTCTCTAACGGTATTTCGGACAA
TAATCGAATCGTTTGGTTAGAGCATGGCACTCTCAAACACGTCCTTCTCGTACCCAAATTGAATTCAAAACCGGT
TTCTGTGCAACAAGCAGAATTCGAATCCTTCGTCGATGTTGGTCTTTCAAAGGACGCGCACATAGTTGCTATCAA
AACCGATGGTGCTGCTCGTGTCATCAAGTTGATTGAGGATGGTATAAAGGGAGTATATGACTTTAAGGATGAGGT
GAGGATCGTAAGATTAATCCACACTAGACATTAATCCGATTTTCAGGCCACCACGAACGAGGAACAACGATTTCC
TGTATATTCAGGCAATGTAGAAGAGACCGGGCGCGTTCATGTTGCGAGGGTCTACTGGAAACAAGATGTCAAGGT
AAATAATGATGTTCTAGAGTTGCTTTTCCCATGATTGATTCGCGAGGCAGCAAGTCGCCCTGGAAATTTATTCAG
GAACGCCAGACTTGAGCTTTAGCTTGTTCGATTTTGACACTCTCAACAATGGAGTTATCAACTTCGCTGCTTTGA
ACGCTCGAGGCACTGGTTCAAATGACGTTGCTCCTAGGCTCCTCATCTCGACGTATACTGGCAATGTTCAACTGG
TTGAAGGCACACAAGTGAAATGGAATAGGGAAGAAGCTTTGACCAGTTCTGTTGTTGCCGAATTTGCCGAGCTAC
CACCACCAAAAGCGGTGGTGGGTGACCATGAAGGCGAGTCGTTTGTGAGTCGAGTGATCCGTCACGTTGCAGACC
TTCAGGTAAGAGAGTTTGTCCTTGCCTCAATCTATATCAAGCTCATTTGCGTATAGAAATTACCCGCATATATTC
TCCATTTTCTGAAGCGGTTTGTCATGAATCAATCATCCCTTCTAACCACAAAGAACAACATTCAGTCTGATGAAG
CTGTTCGGGATGAGTTCGGCTTTAGACAAATCATTGTGGTGGCCACTATGTTTGGAAAAGTGTATGGCATTGATT
CGGCAACGGGAAATGTCGTCTGGACGAGGTTACTTGGTTTAGGATGGGCCGCCAACGGCGGTGCACGTCTTGCCC
CTTTGAAACTCTATACATTCAATGGGGAGGGTGTTGGTGGAGAGGGCAAGGGCACGAGGTCTGATGTTGTCTTGA
TTGTCCAGAGGACAGCGGCTAATGTAAGCCCTCAACATGCTTTCATCTAAATTTTCTGATTATTTCACTTAGACG
TTGGTTGATACGGTGTTGTTCCACATCGATGCAGCGACAGGACAAGACCTTACAGGTAAAACCGCCGGGAGTGAT
GTGCTTGAGGGCATAGATATCGTACCTGGAGTTATGGTGGAGTCATATATGCTACAACTCAAAGGGCAGAAATTG
GTGATGCTCCTTGACGAATATCTTCAGGTATGCTGATGGTTTCTGTTGCATCATCCGTATGTGTTCTCATGCGAA
CGTCTAGACCTATACATACCCCGACACCCCAGAAGCTTACGACCTGCTAAAAGAGGTTGCTTCTTCATTGTACTT
CCCCTTACGCACCAACTCAAAATCGCCTTCTCCACCTGGTTCTCCCAGGCAACGTCATCTCGTTGGTTACCAGGT
TGGTATGAATGACGAGCTAAGCAAGGACCGTCTGATAGCTCATCCTGTATGGACGTTATCATTCCGAGATGGTGA
AACTGTCGTTGGCCTAGTCAGTCCTCAAAAAGGTCCCGTTGCTAGTTATGGCAAAGTTATGGCAAATCGGACGAC
GTTGTATAAATACTTGAATCCACATATGAATGTGGTTTTGACCGATCAACGACAAGGACGGCCAGTGACGAGGGA
CACGAATGCGACGACACCTACTACGGAGCACCCGGGTTGTGGGGTTTATGTGGTAGATAACGTGAAGGGTTCTAT
TCTATATGAAGCGTCGTTACCTTCACCGGGTCCTGGGATGAAGTGCAATGTCAAGGCTACATTGACTGAAAACTG
GTTGGCGTATCATTATTATGATCCGGAGGAGGCTGCTGTTGAGGAAGCGAGAGGTTGGAGATTAGTTACTGTTGA
GTTCTATGAGGGTGATATCGATAAAAAGACCAAGAGGTACGTCATTTGACAATGCGAATGCAGCTTCTGAGCTGA
CATTTATCGGTAGTTCCGAAGCGTCTAGTTTCTCGGAAGCTAGTACGCAAGTACAGATATTTGAAGATGTTTTTG
TATTCCCGCAAGGAATCACTGCAATGACAATGACTAAGACCAAGTTTGGTATCTCTACAAAAGACTTGATTGGTG
ATTTCGTTCATTCGAGCTACTATTTTCCGTTCATTACTGACCTGGGGATTTCTTTAGTTGCAACGAACAGCAATA
AGATTCAGTCATACCCTAGAAGACTTCTCGACCCTCGTCGACCACGCCGAAAACCTACAAATCAAGAACTCGAAG
AAGGATTAATGCAATATGAGCCCGTCTTGTTCGACCATCCCAAATCCGTCCTTTCACATGAATACGACGTAGCGC
GTACTCAACATATCATCACAGCTCCCTCACTTCTCGAATCCACTTCACTCGTGTTCGCAACTGGTTTAGATATGT
TCCTTACACGGACATCACCGTCTGGGACGTTTGATTTGCTGAGTGAGACGTTTAATAAGAAGCAGTTGATATGGA
CTGTTGGGGGGCTGTTGGTGGCGCTTTTGGTAGCGTGGCCGATGGTGAGGGAGAAAAAATTGAATGGGAAATGGT
ATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail