Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034440
Gene name
Locationscaffold_13:231289..232168
Strand+
Gene length (bp)879
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 2.1E-35 20 238

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 17 248 9.0E-08

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034440
MPKISTLYTPPAQKSPEYREFIPAGAFDGRSPCPALNTLANHGYISRNGHDIHFFELIDALQRVYNVTWVLAFTL
TLVGFLISGKLTFVRDGWFLPSIRWTVSLSTLSMRGPYKIAHNAAFVHPNSVPSHAPDKNLLQRFLTFASSRRSK
SYHRELHGLSLADFALYHKKMEDELHSPLNEFHRQVALGECGLAWAVMRRRSSTGPKGSPIDEREEMVTADVLNQ
WFGSEKLPENWFNEGGLRPVHPIGLLEAKRRAGHVAQMISGWEQYD*
Coding >AgabiH97|034440
ATGCCTAAAATCTCCACTCTTTATACGCCACCGGCACAGAAATCGCCGGAATATCGTGAATTCATCCCTGCTGGA
GCCTTTGATGGTCGTTCACCTTGCCCAGCTTTGAACACCCTCGCGAATCATGGCTACATCTCACGAAATGGCCAT
GATATACACTTTTTTGAGCTCATAGACGCTTTACAACGCGTTTACAACGTCACCTGGGTTCTTGCATTCACCTTG
ACACTCGTGGGGTTCCTAATCAGTGGGAAACTCACGTTCGTTCGTGATGGATGGTTTCTTCCATCCATTCGATGG
ACCGTCAGCCTCTCAACCTTGTCTATGCGAGGACCATACAAAATCGCCCACAACGCTGCTTTTGTTCACCCTAAC
AGTGTCCCATCCCACGCCCCCGACAAAAACCTACTTCAAAGATTCCTTACCTTCGCTTCATCGCGTCGTAGCAAA
TCTTATCACCGTGAACTACATGGACTATCTTTGGCCGATTTCGCTCTCTACCACAAGAAAATGGAAGATGAGCTT
CATTCGCCCCTCAACGAGTTTCATAGACAAGTTGCTTTGGGGGAGTGTGGACTCGCATGGGCAGTCATGCGAAGG
AGATCATCCACGGGACCTAAAGGAAGCCCGATTGATGAACGGGAAGAGATGGTCACAGCGGACGTTTTGAATCAA
TGGTTTGGCAGTGAGAAGTTGCCAGAGAATTGGTTCAACGAAGGTGGTTTGAGGCCAGTGCATCCGATTGGTCTC
TTGGAGGCGAAACGCCGAGCAGGACATGTCGCCCAGATGATCTCCGGCTGGGAACAATACGACTAA
Transcript >AgabiH97|034440
ATGCCTAAAATCTCCACTCTTTATACGCCACCGGCACAGAAATCGCCGGAATATCGTGAATTCATCCCTGCTGGA
GCCTTTGATGGTCGTTCACCTTGCCCAGCTTTGAACACCCTCGCGAATCATGGCTACATCTCACGAAATGGCCAT
GATATACACTTTTTTGAGCTCATAGACGCTTTACAACGCGTTTACAACGTCACCTGGGTTCTTGCATTCACCTTG
ACACTCGTGGGGTTCCTAATCAGTGGGAAACTCACGTTCGTTCGTGATGGATGGTTTCTTCCATCCATTCGATGG
ACCGTCAGCCTCTCAACCTTGTCTATGCGAGGACCATACAAAATCGCCCACAACGCTGCTTTTGTTCACCCTAAC
AGTGTCCCATCCCACGCCCCCGACAAAAACCTACTTCAAAGATTCCTTACCTTCGCTTCATCGCGTCGTAGCAAA
TCTTATCACCGTGAACTACATGGACTATCTTTGGCCGATTTCGCTCTCTACCACAAGAAAATGGAAGATGAGCTT
CATTCGCCCCTCAACGAGTTTCATAGACAAGTTGCTTTGGGGGAGTGTGGACTCGCATGGGCAGTCATGCGAAGG
AGATCATCCACGGGACCTAAAGGAAGCCCGATTGATGAACGGGAAGAGATGGTCACAGCGGACGTTTTGAATCAA
TGGTTTGGCAGTGAGAAGTTGCCAGAGAATTGGTTCAACGAAGGTGGTTTGAGGCCAGTGCATCCGATTGGTCTC
TTGGAGGCGAAACGCCGAGCAGGACATGTCGCCCAGATGATCTCCGGCTGGGAACAATACGACTAA
Gene >AgabiH97|034440
ATGCCTAAAATCTCCACTCTTTATACGCCACCGGCACAGAAATCGCCGGAATATCGTGAATTCATCCCTGCTGGA
GCCTTTGATGGTCGTTCACCTTGCCCAGCTTTGAACACCCTCGCGAATCATGGCTACATGTTAGAGCATTCACTC
TCTTTCTAGTCCCATTTGACTAATCTCCTAATCTTCTGATCATGTAGCTCACGAAATGGCCATGATATACACTTT
TTTGAGCTCATAGACGCTTTACAACGCGTTTACAACGTCACCTGGGTTCTTGCATTCACCTTGACACTCGTGGGG
TTCCTAATCAGTGGGAAACTCACGTTCGTTCGTGATGGATGGTTTCTTCCATCCATTCGATGGACCGTCAGCCTC
TCAACCTTGTCTATGCGAGGACCATACAAAATCGCCCACAACGCTGCTTTTGTTCACCCTAACAGTGTCCCATCC
CACGCCCCCGACAAAAACCTACTTCAAAGATTCCTTACCTTCGCTTCATCGCGTCGTAGCAAATCTTATCACCGT
GAACTACATGGACTATCTTTGGCCGATTTCGCTCTCTACCACAAGAAAATGGAAGATGAGCTTCATTCGCCCCTC
AACGAGTTTCATAGACAAGTTGCTTTGGGGGAGTGTGGACTCGCATGGGCAGTCATGCGAAGGAGATCATCCACG
GGACCTAAAGGAAGCCCGATTGATGAACGGGAAGAGATGGTCACAGCGGACGTTTTGAATCAATGGTTTGGCAGT
GAGAAGTTGCCAGAGAATTGGTTCAACGAAGGTGGTTTGAGGCCAGTGCATCCGATTGGTCTCTTGGAGGCGAAA
CGCCGAGCAGGACATGTCGCCCAGATGATCTCCGGCTGGGAACAATACGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail