Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034370
Gene name
Locationscaffold_13:213368..213895
Strand+
Gene length (bp)527
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 2.1E-11 24 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 25 115 6.0E-11
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 6 115 3.0E-10
sp|Q9ZP41|EGC_CITJA EG45-like domain containing protein OS=Citrus jambhiri GN=CjBAp12 PE=1 SV=1 19 113 2.0E-08
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 25 114 6.0E-08
sp|Q9M0C2|EGC1_ARATH Putative EG45-like domain containing protein 1 OS=Arabidopsis thaliana GN=EGC1 PE=3 SV=1 22 112 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 25 115 6.0E-11
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 6 115 3.0E-10
sp|Q9ZP41|EGC_CITJA EG45-like domain containing protein OS=Citrus jambhiri GN=CjBAp12 PE=1 SV=1 19 113 2.0E-08
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 25 114 6.0E-08
sp|Q9M0C2|EGC1_ARATH Putative EG45-like domain containing protein 1 OS=Arabidopsis thaliana GN=EGC1 PE=3 SV=1 22 112 1.0E-06
sp|Q9ZV52|EGC2_ARATH EG45-like domain containing protein 2 OS=Arabidopsis thaliana GN=EGC2 PE=2 SV=2 7 110 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 408.96 189.36 628.57
Initials Initials knots 76.74 37.02 116.46
Pileal_Stipeal_center Stage I stipe center 286.13 164.62 407.64
Pileal_Stipeal_shell Stage I stipe shell 91.24 45.32 137.16
DIF_stipe_center Stage II stipe center 311.87 180.62 443.13
DIF_stipe_shell Stage II stipe shell 442.58 262.76 622.39
DIF_stipe_skin Stage II stipe skin 393.61 229.14 558.08
DIF_cap_skin Stage II cap skin 82.37 40.33 124.41
DIF_cap_tissue Stage II cap tissue 114.85 58.99 170.71
DIF_gill_tissue Stage II gill tissue 147.71 78.22 217.19
YFB_stipe_center Young fruiting body stipe center 800.12 462.16 1138.07
YFB_stipe_shell Young fruiting body stipe shell 1121.83 650.77 1592.89
YFB_stipe_skin Young fruiting body stipe skin 1126.22 650.70 1601.73
YFB_cap_skin Young fruiting body cap skin 123.36 62.87 183.85
YFB_cap_tissue Young fruiting body cap tissue 179.72 97.52 261.91
YFB_gill_tissue Young fruiting body gill tissue 150.02 79.44 220.60
YFB_veil Young fruiting body veil 129.32 64.64 193.99

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.031323 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.008457 yes
Casing YFB_gill_tissue 0.001140 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.336942 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.497077 no
Casing DIF_stipe_shell 0.885780 no
Casing DIF_stipe_skin 0.948962 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.711846 no
DIF_gill_tissue YFB_cap_tissue 0.668535 no
DIF_gill_tissue YFB_gill_tissue 0.980349 no
DIF_gill_tissue YFB_veil 0.808426 no
YFB_stipe_center YFB_stipe_shell 0.294933 no
YFB_stipe_center YFB_stipe_skin 0.286806 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.993471 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.304111 no
YFB_cap_skin YFB_gill_tissue 0.680183 no
YFB_cap_skin YFB_veil 0.941965 no
YFB_cap_tissue YFB_gill_tissue 0.703835 no
YFB_cap_tissue YFB_veil 0.410474 no
YFB_gill_tissue YFB_veil 0.781251 no
Initials DIF_gill_tissue 0.049467 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.199869 no
Initials YFB_cap_tissue 0.007782 yes
Initials YFB_gill_tissue 0.047373 yes
Initials YFB_veil 0.163434 no
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.748333 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.912629 no
Initials DIF_cap_tissue 0.308631 no
Pileal_Stipeal_center DIF_gill_tissue 0.023153 yes
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_skin 0.004160 yes
Pileal_Stipeal_center YFB_cap_tissue 0.140001 no
Pileal_Stipeal_center YFB_gill_tissue 0.030610 yes
Pileal_Stipeal_center YFB_veil 0.012577 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.863175 no
Pileal_Stipeal_center DIF_stipe_shell 0.140144 no
Pileal_Stipeal_center DIF_stipe_skin 0.335056 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.002525 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.169576 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.471961 no
Pileal_Stipeal_shell YFB_cap_tissue 0.031323 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.165674 no
Pileal_Stipeal_shell YFB_veil 0.397755 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.863630 no
Pileal_Stipeal_shell DIF_cap_tissue 0.624699 no
DIF_stipe_center DIF_gill_tissue 0.010412 yes
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.000613 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.064141 no
DIF_stipe_center YFB_gill_tissue 0.013485 yes
DIF_stipe_center YFB_veil 0.004928 yes
DIF_stipe_center DIF_stipe_shell 0.252288 no
DIF_stipe_center DIF_stipe_skin 0.522533 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.001140 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.027943 yes
DIF_stipe_shell YFB_stipe_shell 0.000613 yes
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.793252 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.008121 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.000613 yes
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.004928 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.077517 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.278378 no
DIF_cap_skin YFB_cap_tissue 0.011968 yes
DIF_cap_skin YFB_gill_tissue 0.071782 no
DIF_cap_skin YFB_veil 0.226152 no
DIF_cap_skin DIF_cap_tissue 0.420497 no
DIF_cap_tissue DIF_gill_tissue 0.567883 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.908018 no
DIF_cap_tissue YFB_cap_tissue 0.203158 no
DIF_cap_tissue YFB_gill_tissue 0.533691 no
DIF_cap_tissue YFB_veil 0.838617 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034370
MKFSNSLSALLVSANLMLAAKAYKGDATFYDPGLGACGHTNQAHELVAALPSAKYGSGDHCSKHVGIHYKGKYVK
VKVVDKCPGCGSNDLDISPTAFSQLASQDLGRIKVDWEFL*
Coding >AgabiH97|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGCCACCTTTTATGATCCTGGTCTGGGAGCTTGTGGCCATACGAATCAGGCTCATGAACTTGTCGCTGCCCTT
CCATCAGCCAAATACGGCAGCGGAGACCATTGTTCCAAGCATGTCGGCATCCACTACAAAGGCAAATACGTGAAA
GTCAAAGTAGTCGACAAATGTCCCGGTTGTGGTTCGAACGATTTAGACATCTCACCAACCGCATTCTCTCAGTTA
GCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCTGA
Transcript >AgabiH97|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGCCACCTTTTATGATCCTGGTCTGGGAGCTTGTGGCCATACGAATCAGGCTCATGAACTTGTCGCTGCCCTT
CCATCAGCCAAATACGGCAGCGGAGACCATTGTTCCAAGCATGTCGGCATCCACTACAAAGGCAAATACGTGAAA
GTCAAAGTAGTCGACAAATGTCCCGGTTGTGGTTCGAACGATTTAGACATCTCACCAACCGCATTCTCTCAGTTA
GCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCTGA
Gene >AgabiH97|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGGTCAGTTATGACAGTGTCGCCCATCCTATCGTCAATGATGCTGATTTTGTTCTCCCACCTTTTTAGCCACC
TTTTATGATCCTGGTGTACGTTTTTCTTACACTTTTCACCAAGATTCCTCACCCACTGGTTTCAAAATTAGCTGG
GAGCTTGTGGCCATACGAATCAGGCTCATGAACTTGTCGCTGCCCTTCCATCAGCCAAATACGGCAGCGGAGACC
ATTGTTCCAAGCATGTCGGCATCCACTGTAAGCTTCCTCCTTCTACTCCCTCCTCAAAAACCAAAATTCATTCAT
TGCAATAAGACAAAGGCAAATACGTGAAAGTCAAAGTAGTCGACAAATGTCCCGGTTGTGGTTCGAACGATTTAG
ACATCTCACCAACCGCATTCTCTCAGTTAGCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail