Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034370
Gene name
Locationscaffold_13:213368..213895
Strand+
Gene length (bp)527
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 2.1E-11 24 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 25 115 6.0E-11
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 6 115 3.0E-10
sp|Q9ZP41|EGC_CITJA EG45-like domain containing protein OS=Citrus jambhiri GN=CjBAp12 PE=1 SV=1 19 113 2.0E-08
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 25 114 6.0E-08
sp|Q9M0C2|EGC1_ARATH Putative EG45-like domain containing protein 1 OS=Arabidopsis thaliana GN=EGC1 PE=3 SV=1 22 112 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 25 115 6.0E-11
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 6 115 3.0E-10
sp|Q9ZP41|EGC_CITJA EG45-like domain containing protein OS=Citrus jambhiri GN=CjBAp12 PE=1 SV=1 19 113 2.0E-08
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 25 114 6.0E-08
sp|Q9M0C2|EGC1_ARATH Putative EG45-like domain containing protein 1 OS=Arabidopsis thaliana GN=EGC1 PE=3 SV=1 22 112 1.0E-06
sp|Q9ZV52|EGC2_ARATH EG45-like domain containing protein 2 OS=Arabidopsis thaliana GN=EGC2 PE=2 SV=2 7 110 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034370
MKFSNSLSALLVSANLMLAAKAYKGDATFYDPGLGACGHTNQAHELVAALPSAKYGSGDHCSKHVGIHYKGKYVK
VKVVDKCPGCGSNDLDISPTAFSQLASQDLGRIKVDWEFL*
Coding >AgabiH97|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGCCACCTTTTATGATCCTGGTCTGGGAGCTTGTGGCCATACGAATCAGGCTCATGAACTTGTCGCTGCCCTT
CCATCAGCCAAATACGGCAGCGGAGACCATTGTTCCAAGCATGTCGGCATCCACTACAAAGGCAAATACGTGAAA
GTCAAAGTAGTCGACAAATGTCCCGGTTGTGGTTCGAACGATTTAGACATCTCACCAACCGCATTCTCTCAGTTA
GCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCTGA
Transcript >AgabiH97|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGCCACCTTTTATGATCCTGGTCTGGGAGCTTGTGGCCATACGAATCAGGCTCATGAACTTGTCGCTGCCCTT
CCATCAGCCAAATACGGCAGCGGAGACCATTGTTCCAAGCATGTCGGCATCCACTACAAAGGCAAATACGTGAAA
GTCAAAGTAGTCGACAAATGTCCCGGTTGTGGTTCGAACGATTTAGACATCTCACCAACCGCATTCTCTCAGTTA
GCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCTGA
Gene >AgabiH97|034370
ATGAAATTCTCCAATTCTCTATCCGCTCTCCTCGTATCCGCGAATCTCATGTTGGCAGCGAAGGCCTACAAAGGA
GATGGTCAGTTATGACAGTGTCGCCCATCCTATCGTCAATGATGCTGATTTTGTTCTCCCACCTTTTTAGCCACC
TTTTATGATCCTGGTGTACGTTTTTCTTACACTTTTCACCAAGATTCCTCACCCACTGGTTTCAAAATTAGCTGG
GAGCTTGTGGCCATACGAATCAGGCTCATGAACTTGTCGCTGCCCTTCCATCAGCCAAATACGGCAGCGGAGACC
ATTGTTCCAAGCATGTCGGCATCCACTGTAAGCTTCCTCCTTCTACTCCCTCCTCAAAAACCAAAATTCATTCAT
TGCAATAAGACAAAGGCAAATACGTGAAAGTCAAAGTAGTCGACAAATGTCCCGGTTGTGGTTCGAACGATTTAG
ACATCTCACCAACCGCATTCTCTCAGTTAGCCAGTCAAGACCTCGGCCGTATCAAAGTAGATTGGGAATTTCTCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail