Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034290
Gene name
Locationscaffold_13:192482..193022
Strand-
Gene length (bp)540
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07249 Cerato-platanin Cerato-platanin 2.3E-16 34 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9CX44|AG19_COCPS Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CSA PE=1 SV=1 12 121 4.0E-16
sp|P0CW95|AG19_COCP7 Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain C735) GN=CSA PE=1 SV=1 12 121 4.0E-16
sp|Q1E8D2|AG19_COCIM Heat-stable 19 kDa antigen OS=Coccidioides immitis (strain RS) GN=CSA PE=3 SV=1 12 121 7.0E-16
sp|D4ALV6|AL15_ARTBC Allergen Asp f 15 homolg OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05304 PE=1 SV=1 1 130 3.0E-12
sp|O60022|AL15_ASPFU Allergen Asp f 15 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G12630 PE=1 SV=1 1 130 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9CX44|AG19_COCPS Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CSA PE=1 SV=1 12 121 4.0E-16
sp|P0CW95|AG19_COCP7 Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain C735) GN=CSA PE=1 SV=1 12 121 4.0E-16
sp|Q1E8D2|AG19_COCIM Heat-stable 19 kDa antigen OS=Coccidioides immitis (strain RS) GN=CSA PE=3 SV=1 12 121 7.0E-16
sp|D4ALV6|AL15_ARTBC Allergen Asp f 15 homolg OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05304 PE=1 SV=1 1 130 3.0E-12
sp|O60022|AL15_ASPFU Allergen Asp f 15 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G12630 PE=1 SV=1 1 130 3.0E-10
sp|O74238|SNP1_PHANO Protein SnodProt1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13722 PE=2 SV=1 18 96 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034290
MQFTSTFALLASTLTAIPAMAFALAPRSPTAVFNYDTRYDEPNVSLSTTSCSADAGNLEGHKTFGSIPNFPHIVG
SFVAGGFNSTECGACYNLTYTPMDGGEPTVIPFTVINDDQKGFTISLAMFLSITRKFQSTSVASKEYLSVYF*
Coding >AgabiH97|034290
ATGCAATTCACTTCTACCTTCGCTCTTCTCGCCTCTACTCTCACTGCCATCCCTGCTATGGCTTTTGCTCTGGCT
CCCAGGAGTCCTACTGCAGTGTTCAACTATGACACTCGCTACGACGAGCCTAATGTGTCGCTCAGCACTACTTCG
TGCTCCGCAGATGCGGGTAATCTCGAGGGACACAAGACCTTTGGGTCAATCCCTAACTTCCCCCACATTGTTGGG
TCTTTTGTTGCCGGGGGTTTCAACTCGACTGAATGTGGAGCTTGCTATAACCTCACGTACACCCCCATGGATGGC
GGTGAACCGACTGTCATTCCCTTCACGGTTATCAACGATGACCAGAAAGGTTTCACAATTTCCCTGGCGATGTTC
CTATCTATTACGAGGAAGTTCCAATCCACTTCTGTGGCTTCTAAAGAATATCTGTCTGTTTATTTCTGA
Transcript >AgabiH97|034290
ATGCAATTCACTTCTACCTTCGCTCTTCTCGCCTCTACTCTCACTGCCATCCCTGCTATGGCTTTTGCTCTGGCT
CCCAGGAGTCCTACTGCAGTGTTCAACTATGACACTCGCTACGACGAGCCTAATGTGTCGCTCAGCACTACTTCG
TGCTCCGCAGATGCGGGTAATCTCGAGGGACACAAGACCTTTGGGTCAATCCCTAACTTCCCCCACATTGTTGGG
TCTTTTGTTGCCGGGGGTTTCAACTCGACTGAATGTGGAGCTTGCTATAACCTCACGTACACCCCCATGGATGGC
GGTGAACCGACTGTCATTCCCTTCACGGTTATCAACGATGACCAGAAAGGTTTCACAATTTCCCTGGCGATGTTC
CTATCTATTACGAGGAAGTTCCAATCCACTTCTGTGGCTTCTAAAGAATATCTGTCTGTTTATTTCTGA
Gene >AgabiH97|034290
ATGCAATTCACTTCTACCTTCGCTCTTCTCGCCTCTACTCTCACTGCCATCCCTGCTATGGCTTTTGCTCTGGCT
CCCAGGAGTCCTACTGCAGTGTTCAACTATGACACTCGCTACGACGAGCCTAATGTGTCGCTCAGCACTACTTCG
TGCTCCGCAGATGCGGGTAATCTCGAGGGACACAAGACCTTTGGGTCAATCCCTAACTTCCCCCACATTGTTGGG
TCTTTTGTTGCCGGGGGTTTCAACTCGACTGAATGTGGAGCTTGCTATAACCTCACGTACACCCCCATGGATGGC
GGTGAACCGACTGTCATTCCCTTCACGGTTATCAACGATGACCAGAAAGGTTTCACGTCCAGTGTTCAGGGCTTG
AAGGATTTGACGGGATTTGATATCGAGAATTTCCCTGGCGATGTTCCTATCTATTACGAGGAAGTTCCAATCCAC
TTCTGTGGCTTCTAAAGGTAAAACATCATTCACATTTATTGGAAACTAATAACTGATGTTTCTTTAGAATATCTG
TCTGTTTATTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail