Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|034250
Gene name
Locationscaffold_13:185054..186630
Strand-
Gene length (bp)1576
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 2.9E-28 76 360

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80402|DBD23_ASPOR 2,3-dihydroxybenzoate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000447 PE=1 SV=2 34 335 2.0E-78
sp|P0CT50|SDC_TRIMF Salicylate decarboxylase OS=Trichosporon moniliiforme GN=sdc PE=1 SV=1 34 362 2.0E-71
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 65 362 3.0E-17
sp|Q8TDX5|ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens GN=ACMSD PE=1 SV=1 23 362 7.0E-17
sp|Q8R5M5|ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus GN=Acmsd PE=1 SV=1 23 362 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80402|DBD23_ASPOR 2,3-dihydroxybenzoate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000447 PE=1 SV=2 34 335 2.0E-78
sp|P0CT50|SDC_TRIMF Salicylate decarboxylase OS=Trichosporon moniliiforme GN=sdc PE=1 SV=1 34 362 2.0E-71
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 65 362 3.0E-17
sp|Q8TDX5|ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens GN=ACMSD PE=1 SV=1 23 362 7.0E-17
sp|Q8R5M5|ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus GN=Acmsd PE=1 SV=1 23 362 3.0E-16
sp|Q8R519|ACMSD_MOUSE 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Mus musculus GN=Acmsd PE=1 SV=2 23 362 3.0E-15
sp|Q54LN9|ACMSD_DICDI 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Dictyostelium discoideum GN=acmsd PE=3 SV=1 64 361 3.0E-15
sp|P80346|DBD23_ASPNG 2,3-dihydroxybenzoate decarboxylase (Fragments) OS=Aspergillus niger PE=1 SV=1 34 168 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|034250
MLSLAALRLVILGVCVLNSLPKVLSKEWRNSGNGRIVLEEAWTIPELIHQIGNTSAALGGTNAELKANLLDIHNQ
RRQFMDENNIDFMVVSCANPCIQGLSDPVEAENMAVTVNNRLAETIANDTERFGGFASLSMHNATNAALELNRTV
TELGFVGALVNDYQQSGPDNTTLLYYDQPEYDVFWQMVSDLDVPVYFHPRSNIAQIGSLMTGHARWLKGPAQEFA
ATLSNHILGLCTNGVFDRFPKAKIIVGHLGERIPSDLGRIDEQLLRQIPNGIPMKLNVSSYWQTNIWETTSGNFQ
TPLMKFHMDTIGLNRIMYSVDYPYVAIPEGEAWLQTLPSVLSAEELNSLTRNVAIEVLGLNK*
Coding >AgabiH97|034250
ATGCTTTCTCTTGCCGCACTACGACTTGTCATTCTTGGGGTCTGTGTCTTGAACAGTCTTCCGAAAGTCCTTTCC
AAAGAGTGGAGGAATAGTGGAAACGGAAGAATCGTTCTTGAAGAAGCCTGGACTATCCCAGAGCTTATTCATCAG
ATCGGTAACACAAGCGCGGCATTGGGAGGGACAAATGCAGAATTGAAGGCGAATTTGTTAGACATTCATAATCAA
CGTCGTCAATTCATGGATGAAAATAATATCGATTTTATGGTTGTGTCTTGTGCTAACCCGTGTATTCAAGGATTA
TCTGATCCTGTTGAGGCCGAAAATATGGCAGTCACGGTAAACAACAGGCTCGCGGAAACCATTGCCAACGACACG
GAAAGGTTCGGAGGCTTTGCTTCGTTGTCAATGCACAATGCCACGAATGCCGCCCTTGAACTGAACCGTACCGTC
ACAGAGCTTGGTTTTGTAGGAGCATTGGTAAACGACTACCAACAGTCCGGACCTGATAACACCACACTTCTTTAT
TACGATCAGCCCGAATATGACGTGTTTTGGCAAATGGTCTCTGACCTTGACGTGCCTGTTTATTTCCATCCGCGG
TCCAACATCGCGCAAATAGGCAGCCTCATGACCGGACATGCGAGATGGCTCAAAGGCCCTGCCCAAGAATTCGCC
GCCACTCTGTCAAACCACATTTTGGGGCTTTGTACGAACGGAGTTTTCGACCGATTTCCCAAGGCAAAAATTATC
GTAGGCCACCTGGGTGAACGCATTCCGTCAGACCTTGGCAGGATAGACGAACAACTCTTGCGTCAAATACCGAAC
GGCATACCAATGAAACTCAACGTCAGCTCTTATTGGCAGACCAATATTTGGGAGACAACATCTGGGAACTTTCAA
ACTCCTCTGATGAAATTCCACATGGACACTATTGGGTTAAATCGTATCATGTATTCCGTTGATTATCCCTATGTT
GCAATACCTGAAGGTGAAGCTTGGCTTCAAACTTTGCCTTCGGTTCTTTCTGCGGAGGAGTTGAACAGTCTTACA
CGTAACGTCGCTATTGAGGTTTTGGGATTGAACAAGTAG
Transcript >AgabiH97|034250
ATGCTTTCTCTTGCCGCACTACGACTTGTCATTCTTGGGGTCTGTGTCTTGAACAGTCTTCCGAAAGTCCTTTCC
AAAGAGTGGAGGAATAGTGGAAACGGAAGAATCGTTCTTGAAGAAGCCTGGACTATCCCAGAGCTTATTCATCAG
ATCGGTAACACAAGCGCGGCATTGGGAGGGACAAATGCAGAATTGAAGGCGAATTTGTTAGACATTCATAATCAA
CGTCGTCAATTCATGGATGAAAATAATATCGATTTTATGGTTGTGTCTTGTGCTAACCCGTGTATTCAAGGATTA
TCTGATCCTGTTGAGGCCGAAAATATGGCAGTCACGGTAAACAACAGGCTCGCGGAAACCATTGCCAACGACACG
GAAAGGTTCGGAGGCTTTGCTTCGTTGTCAATGCACAATGCCACGAATGCCGCCCTTGAACTGAACCGTACCGTC
ACAGAGCTTGGTTTTGTAGGAGCATTGGTAAACGACTACCAACAGTCCGGACCTGATAACACCACACTTCTTTAT
TACGATCAGCCCGAATATGACGTGTTTTGGCAAATGGTCTCTGACCTTGACGTGCCTGTTTATTTCCATCCGCGG
TCCAACATCGCGCAAATAGGCAGCCTCATGACCGGACATGCGAGATGGCTCAAAGGCCCTGCCCAAGAATTCGCC
GCCACTCTGTCAAACCACATTTTGGGGCTTTGTACGAACGGAGTTTTCGACCGATTTCCCAAGGCAAAAATTATC
GTAGGCCACCTGGGTGAACGCATTCCGTCAGACCTTGGCAGGATAGACGAACAACTCTTGCGTCAAATACCGAAC
GGCATACCAATGAAACTCAACGTCAGCTCTTATTGGCAGACCAATATTTGGGAGACAACATCTGGGAACTTTCAA
ACTCCTCTGATGAAATTCCACATGGACACTATTGGGTTAAATCGTATCATGTATTCCGTTGATTATCCCTATGTT
GCAATACCTGAAGGTGAAGCTTGGCTTCAAACTTTGCCTTCGGTTCTTTCTGCGGAGGAGTTGAACAGTCTTACA
CGTAACGTCGCTATTGAGGTTTTGGGATTGAACAAGTAG
Gene >AgabiH97|034250
ATGCTTTCTCTTGCCGCACTACGACTTGTCATTCTTGGGGTCTGTGTCTTGAACAGTCTTCCGAAAGTCCTTTCC
AAAGAGTGGAGGAATAGTGGAAACGGAAGAATCGTTCTTGAAGAAGCCTGGACTATCCCAGAGCTTATTCATCAG
ATCGGGTGAGTCCAGATATTTGCGGATGTTCGAAAAGACACTCAGACGTGAACAGTAACACAAGCGCGGCATTGG
GTATCAACAAGTCACGGTTTTTTTCTTCCCCTAGTTGATTTGGCTCCAGGAGGGACAAATGCAGAATTGAAGGCG
AATTTGTTAGACATTCATAATCAACGTCGTCAATTCATGGATGAAAATAATATCGATTTTGTAAGACAATGCCTC
GTAAATCACGTTTGTCTGATCTGCTCACCATCTCATATTCTCTCACAGATGGTTGTGTCTTGTGCTAACCCGTGT
ATTCAAGGATTATCTGATCCTGTTGAGGCCGAAAATATGGCAGTCACGGTAAACAACAGGCTCGCGGAAACCATT
GCCAACGACACGGAAAGGTTCGGAGGCTTTGCTTCGTTGTCAATGCACAATGCCACGAATGCCGCCCTTGAACTG
AACCGTACCGTCACAGAGCTTGGTTTTGTAGGCATGTAGGGTTCCAACATCCCGACTATCGACGCTAAATCTACA
AATTCAGGAGCATTGGTAAACGACTACCAACAGTCCGGACCTGATAACAGTGAGCATCCATTTATCTTCCATAAA
TCACTGTTAGTGACACGCGTTTCAGCCACACTTCTTTATTACGATCAGCCCGAATATGACGTGTTTTGGCAAATG
GTCTCTGACCTTGACGTGCCTGTTTATTTCCATCCGCGGTCCAACATCGCGCAAATAGGCAGCCTCATGACCGGA
CATGCGAGATGGCTCAAAGGCCCTGCCCAAGAATTCGCCGCCACTCTGTCAAACCACATTTTGGGGTATGTAGTT
CGTAATGCGACTAGGTTTCTGACCGATGGGTTTATACCTGTTTCAGGCTTTGTACGAACGGAGTTTTCGAGTAAT
TGTCTACCTCTTCCTTATTCTTGTTGCGACTCATTATGATAATTACAGCCGATTTCCCAAGGCAAAAATTATCGT
AGGCCACCTGGGTGAACGCATTCCGTCAGACCTTGGCAGGATAGACGAACGTAGGTCGTTTTCCTTCCAGAATGA
CACGTAGACTAATATTCTCATCCGTCAGAACTCTTGCGTCAAATACCGAACGGCATACCAATGAAACTCAACGTC
AGCTCTTATTGGCAGACCAATATTTGGGAGACAACATCTGGGAACTTTCAAACTCCTCTGATGAAATTCCACATG
GACACTATTGGGTTAAATCGTATCATGTATTCCGTTGATTATCCCTATGTGAGTAAACAAAGAACGCTTCTGAAG
TTCGAATTCAGGCTATAACTAAGAGCAATTAAAGGTTGCAATACCTGAAGGTGAAGCTTGGCTTCAAACTTTGCC
TTCGGTTCTTTCTGCGGAGGAGTTGAACAGTCTTACACGTAACGTCGCTATTGAGGTTTTGGGATTGAACAAGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail