Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|033980
Gene name
Locationscaffold_13:118593..123529
Strand-
Gene length (bp)4936
Transcript length (bp)3981
Coding sequence length (bp)3981
Protein length (aa) 1327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06292 MUN MUN domain 2.1E-10 671 808
PF00168 C2 C2 domain 3.5E-11 883 971

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.02c PE=3 SV=1 20 1287 7.0E-147
sp|Q08748|YO296_YEAST Uncharacterized protein YOR296W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR296W PE=1 SV=1 614 1272 5.0E-45
sp|Q9P7K5|GIT1_SCHPO Adenylate cyclase activation protein git1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git1 PE=1 SV=1 398 1208 1.0E-24
sp|Q4KUS2|UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus GN=Unc13a PE=1 SV=3 669 857 2.0E-06
sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 669 857 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.02c PE=3 SV=1 20 1287 7.0E-147
sp|Q08748|YO296_YEAST Uncharacterized protein YOR296W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR296W PE=1 SV=1 614 1272 5.0E-45
sp|Q9P7K5|GIT1_SCHPO Adenylate cyclase activation protein git1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git1 PE=1 SV=1 398 1208 1.0E-24
sp|Q4KUS2|UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus GN=Unc13a PE=1 SV=3 669 857 2.0E-06
sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 669 857 2.0E-06
sp|Q9UPW8|UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens GN=UNC13A PE=2 SV=4 669 866 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|033980
MSRRSYDGSAHTRRLSKHRVNDEELFDYVLRVALLSHVISPKPTDAPLAQQEAREREREHSSRLSSLSNFSLGDM
FDSFRDGSKSVKFPEKLLKVLDQRLEKIGMNQDPAYSDQLVRRTMTKFYGQFSVTTFMKQMKESRKIEDLILMFA
THATSVLKKEPTLAVGDGWKLELNNQIAHFIKLLRECLKNVHHVSPELLSRLDAYSAKLTPATAYSDSGYESSST
SRDRDSVYSNYAVTSTGVADMPLVKMVVKLLKLNDRDIQAEVDKLKNGTVTDKAAVTDLKTCLKNINAGAAFPGR
REDFSSDAAWQNWKTIETTHLQQLTVAMVQLNPELAKATSADGYMASSSSYSSPSSNRPGSFYETASRAGSISSR
RSIYDSQNDIYELEDDLPVGHHFTFIPPNPKKYYKRLVEYCLRADLEVMLSPEVDDNDEVSLGILSHPHLELINE
CALRWRIGHPYRATCFLDLVRQFYERNEVPMECVPEALAGVIKAMQDTPLDYWMLSDSDYLVSIYGSLFNVFLSS
LYHAMDAIPNLKPSDIAPYTDLLEQLQDSGLLERTDIDVSARIADIQERIRQITAQWYETKMSDLQTAPGVNKAL
PLLFMTDEIEKYGKLLDKRFPEPISGIIDVVSIYVEIAVPYLATDMQNQQKKLFESSMNGPTPDVPIQDIFALYR
RLKTMMSMYGAFVPSGDFVFDVASFFEPYVRQWLLNTESKTEQWVEAAIAADKFEAEGTEGHSSSIVDLFDSLRS
PINFLQDLEWTDQYQEARFFTHLSKSISNAVEQYRRSVESLFLTEMYPRPTDYLQPQKSSAWLEKARQLTITGEK
KVEPFNFRPESCVKLNNIEAARKLLDKMYEQMQADKVSDVLAHAPPVPEKVERDTFLFSVKIVIAENLVPLDSSP
SSRLDTFVTLSDENGVRVAKTRTIYESLEPRWEETFDISVEKPLWLMVSVRDRALVGKHDIVGRAYLCLDPRRFG
DLLAHELWMDLDTQGRILVRVSMEGEKDDIQFYFGRAFRSLKRAEADMLRIFIDKMSPFINQCLSRNVVKTLLKS
REQGLDYNKALGNVTAFYRSAVGATSADPQIPLPSSEKPRVRPEELTDVEIEQAILPLFDYFDANLQTLNTYLSD
TAKEMVMTRVWKEILTVIEGLLIPPLSDTAIEMKPLSDKEVDIVFKWLKFLRDYFYAGGEGPVPLETLQNQKYRD
VLSIRLYYDWHTDALMEECVRMMQQNFRQAPTMKKRAKSVYQQRNLGTIKERKKEKKQEQESTSEQIIMRILRMR
PRTQEFIAQQMQISAAMQAEQEQRVRETQERKAKRAATRPLSQIPQVPPLP*
Coding >AgabiH97|033980
ATGTCTAGGCGGAGTTATGATGGTTCTGCCCACACCAGACGTCTCTCAAAACATCGTGTGAATGACGAGGAACTC
TTTGACTATGTGCTACGTGTCGCCCTACTCTCTCATGTCATTTCTCCCAAGCCCACGGATGCGCCACTAGCTCAG
CAAGAAGCGCGGGAGCGGGAGCGTGAGCATTCTTCCAGGCTATCGTCTCTTTCGAATTTTTCGTTGGGCGACATG
TTTGACAGCTTTCGGGATGGGTCAAAGAGCGTGAAATTCCCTGAAAAGTTGCTGAAGGTTTTGGATCAGAGGTTG
GAAAAAATTGGTATGAATCAGGATCCGGCATACTCTGATCAACTGGTCCGAAGGACCATGACCAAGTTCTACGGT
CAATTCTCAGTGACTACTTTCATGAAGCAGATGAAGGAAAGCCGAAAGATCGAAGACCTCATCCTGATGTTTGCA
ACTCACGCAACCAGTGTGCTCAAGAAAGAACCAACGCTGGCGGTTGGCGATGGCTGGAAGCTTGAACTCAACAAC
CAAATCGCACATTTCATTAAGCTACTCAGAGAATGTCTGAAGAACGTTCACCATGTGTCACCAGAATTACTGTCA
AGGCTAGATGCGTACTCGGCAAAATTGACTCCAGCTACGGCCTACAGTGACTCCGGATATGAATCCAGTTCGACC
TCTAGAGACAGGGATTCGGTCTATTCCAATTATGCAGTGACTAGTACGGGAGTAGCAGATATGCCGCTAGTGAAG
ATGGTTGTCAAGTTGTTGAAGTTGAATGATCGGGATATACAGGCCGAGGTAGATAAACTTAAGAATGGAACTGTG
ACAGACAAGGCTGCTGTTACGGATCTTAAGACCTGTTTGAAGAACATCAACGCTGGAGCAGCCTTTCCTGGTCGT
CGAGAAGACTTTTCGAGTGACGCAGCATGGCAAAACTGGAAAACAATTGAAACTACACACCTACAACAACTCACA
GTCGCCATGGTACAACTGAATCCCGAGCTTGCGAAAGCGACGTCGGCAGATGGTTACATGGCTAGTAGCTCAAGC
TACTCGTCTCCAAGCTCAAACCGACCAGGATCCTTCTATGAAACGGCTTCAAGAGCAGGATCCATCAGTAGCAGA
CGATCAATTTACGACTCTCAAAATGACATTTACGAACTTGAAGACGACCTTCCCGTAGGCCATCATTTCACATTC
ATTCCACCAAATCCCAAAAAATATTACAAACGACTCGTGGAGTATTGTCTACGCGCGGATTTGGAAGTCATGTTG
AGTCCAGAGGTGGATGATAACGATGAAGTTTCTTTAGGGATTCTGTCGCATCCTCATTTGGAATTGATCAACGAA
TGTGCGTTGAGATGGAGGATAGGACATCCTTATAGGGCGACGTGTTTCCTGGATTTGGTGAGACAGTTTTATGAG
AGGAACGAGGTACCGATGGAGTGTGTACCGGAAGCATTAGCGGGTGTGATAAAGGCGATGCAGGATACACCGTTG
GATTATTGGATGCTTTCGGATTCTGATTATCTTGTCAGCATCTATGGCAGTCTTTTTAACGTCTTTCTTTCCTCC
TTATACCATGCGATGGACGCTATACCCAATCTCAAACCTTCCGACATCGCTCCATATACCGATCTGTTGGAACAG
TTACAAGATAGTGGATTATTGGAGCGTACTGATATTGACGTTTCTGCGCGTATTGCTGATATTCAGGAACGAATA
CGTCAAATTACAGCGCAGTGGTATGAGACGAAGATGAGTGACTTACAAACTGCTCCTGGGGTTAATAAGGCGCTA
CCATTGCTATTCATGACCGATGAGATTGAAAAGTACGGGAAATTATTGGATAAGAGATTTCCTGAACCTATATCT
GGGATCATTGATGTTGTTTCTATATATGTTGAGATTGCTGTACCGTATCTCGCCACGGACATGCAGAATCAACAA
AAGAAGCTGTTTGAGTCGTCAATGAATGGGCCAACCCCAGACGTACCGATTCAGGATATTTTTGCGTTATACAGG
CGGCTTAAGACGATGATGAGCATGTATGGCGCGTTCGTTCCGAGTGGTGATTTTGTCTTTGACGTGGCTAGTTTC
TTTGAGCCGTATGTTCGACAATGGCTTCTCAATACCGAAAGTAAAACCGAACAATGGGTCGAAGCTGCTATCGCA
GCGGACAAGTTCGAGGCGGAAGGGACTGAAGGACATAGTTCTTCCATCGTCGATCTTTTCGATTCCTTACGAAGT
CCAATCAATTTTTTGCAAGATCTGGAATGGACCGACCAGTATCAAGAAGCACGTTTCTTTACACATCTATCAAAG
AGCATATCAAACGCCGTAGAACAATATCGCCGCAGTGTTGAATCTCTCTTTTTAACAGAGATGTACCCCCGTCCA
ACCGACTACCTTCAACCTCAAAAATCATCCGCTTGGCTTGAGAAAGCTCGTCAATTAACAATCACAGGCGAAAAG
AAAGTCGAACCATTCAACTTCCGACCAGAATCTTGTGTCAAGCTAAACAATATCGAAGCTGCACGCAAATTGTTG
GATAAGATGTACGAGCAAATGCAAGCTGATAAAGTCTCGGATGTTTTGGCACATGCACCACCCGTACCGGAAAAG
GTTGAGAGGGATACGTTTTTATTTTCAGTGAAGATTGTTATTGCGGAGAATCTTGTGCCTTTGGATAGTAGTCCT
TCGAGTAGGTTGGATACGTTTGTGACGTTGAGTGATGAGAATGGGGTGAGGGTTGCGAAAACGAGGACGATTTAT
GAGTCTTTGGAGCCTAGATGGGAGGAGACGTTTGATATATCCGTAGAGAAGCCGCTTTGGTTAATGGTCAGTGTG
CGCGATAGAGCATTGGTCGGTAAACATGATATCGTCGGACGGGCTTATCTATGCCTTGACCCGCGACGTTTCGGA
GATCTGTTGGCGCATGAATTGTGGATGGATCTAGATACTCAGGGAAGGATATTGGTCAGGGTCAGTATGGAGGGA
GAGAAAGATGATATTCAGTTCTATTTCGGTCGAGCGTTCCGCTCATTGAAGAGAGCTGAAGCTGATATGTTGAGG
ATTTTCATCGACAAGATGTCACCATTCATCAATCAATGTCTATCTCGAAACGTCGTCAAGACACTTCTCAAATCT
AGAGAACAAGGCTTAGACTATAACAAAGCTCTTGGCAACGTGACAGCTTTCTATCGCTCTGCTGTTGGTGCTACT
TCTGCAGACCCACAGATACCTTTGCCGTCTTCGGAAAAGCCGCGTGTGCGACCTGAGGAACTCACGGATGTGGAA
ATTGAACAGGCGATATTACCCCTGTTTGATTATTTTGACGCGAATTTGCAGACGTTAAACACATATTTGAGTGAT
ACAGCGAAGGAGATGGTGATGACGAGGGTTTGGAAGGAGATTTTGACTGTTATTGAGGGATTGTTGATTCCTCCA
CTTTCGGATACGGCTATTGAGATGAAGCCGTTGAGCGACAAGGAAGTGGATATTGTGTTCAAGTGGCTCAAGTTC
TTGAGGGACTACTTCTATGCCGGAGGCGAAGGCCCAGTACCGCTCGAAACGTTACAGAACCAGAAGTATCGAGAT
GTTTTGTCAATACGACTTTACTATGATTGGCACACAGATGCGTTAATGGAGGAATGCGTGCGGATGATGCAGCAG
AATTTCCGACAGGCACCGACAATGAAGAAACGCGCTAAAAGTGTATATCAACAACGTAACCTGGGGACTATCAAG
GAGAGGAAGAAGGAAAAGAAGCAGGAACAAGAATCGACGAGCGAGCAAATCATAATGCGGATCTTGCGCATGAGA
CCGAGGACACAAGAGTTTATAGCTCAGCAAATGCAAATATCAGCCGCCATGCAAGCTGAACAGGAACAACGTGTG
CGAGAGACACAAGAGAGAAAGGCAAAACGGGCCGCTACAAGACCTTTGAGTCAGATTCCTCAGGTTCCTCCACTA
CCATAA
Transcript >AgabiH97|033980
ATGTCTAGGCGGAGTTATGATGGTTCTGCCCACACCAGACGTCTCTCAAAACATCGTGTGAATGACGAGGAACTC
TTTGACTATGTGCTACGTGTCGCCCTACTCTCTCATGTCATTTCTCCCAAGCCCACGGATGCGCCACTAGCTCAG
CAAGAAGCGCGGGAGCGGGAGCGTGAGCATTCTTCCAGGCTATCGTCTCTTTCGAATTTTTCGTTGGGCGACATG
TTTGACAGCTTTCGGGATGGGTCAAAGAGCGTGAAATTCCCTGAAAAGTTGCTGAAGGTTTTGGATCAGAGGTTG
GAAAAAATTGGTATGAATCAGGATCCGGCATACTCTGATCAACTGGTCCGAAGGACCATGACCAAGTTCTACGGT
CAATTCTCAGTGACTACTTTCATGAAGCAGATGAAGGAAAGCCGAAAGATCGAAGACCTCATCCTGATGTTTGCA
ACTCACGCAACCAGTGTGCTCAAGAAAGAACCAACGCTGGCGGTTGGCGATGGCTGGAAGCTTGAACTCAACAAC
CAAATCGCACATTTCATTAAGCTACTCAGAGAATGTCTGAAGAACGTTCACCATGTGTCACCAGAATTACTGTCA
AGGCTAGATGCGTACTCGGCAAAATTGACTCCAGCTACGGCCTACAGTGACTCCGGATATGAATCCAGTTCGACC
TCTAGAGACAGGGATTCGGTCTATTCCAATTATGCAGTGACTAGTACGGGAGTAGCAGATATGCCGCTAGTGAAG
ATGGTTGTCAAGTTGTTGAAGTTGAATGATCGGGATATACAGGCCGAGGTAGATAAACTTAAGAATGGAACTGTG
ACAGACAAGGCTGCTGTTACGGATCTTAAGACCTGTTTGAAGAACATCAACGCTGGAGCAGCCTTTCCTGGTCGT
CGAGAAGACTTTTCGAGTGACGCAGCATGGCAAAACTGGAAAACAATTGAAACTACACACCTACAACAACTCACA
GTCGCCATGGTACAACTGAATCCCGAGCTTGCGAAAGCGACGTCGGCAGATGGTTACATGGCTAGTAGCTCAAGC
TACTCGTCTCCAAGCTCAAACCGACCAGGATCCTTCTATGAAACGGCTTCAAGAGCAGGATCCATCAGTAGCAGA
CGATCAATTTACGACTCTCAAAATGACATTTACGAACTTGAAGACGACCTTCCCGTAGGCCATCATTTCACATTC
ATTCCACCAAATCCCAAAAAATATTACAAACGACTCGTGGAGTATTGTCTACGCGCGGATTTGGAAGTCATGTTG
AGTCCAGAGGTGGATGATAACGATGAAGTTTCTTTAGGGATTCTGTCGCATCCTCATTTGGAATTGATCAACGAA
TGTGCGTTGAGATGGAGGATAGGACATCCTTATAGGGCGACGTGTTTCCTGGATTTGGTGAGACAGTTTTATGAG
AGGAACGAGGTACCGATGGAGTGTGTACCGGAAGCATTAGCGGGTGTGATAAAGGCGATGCAGGATACACCGTTG
GATTATTGGATGCTTTCGGATTCTGATTATCTTGTCAGCATCTATGGCAGTCTTTTTAACGTCTTTCTTTCCTCC
TTATACCATGCGATGGACGCTATACCCAATCTCAAACCTTCCGACATCGCTCCATATACCGATCTGTTGGAACAG
TTACAAGATAGTGGATTATTGGAGCGTACTGATATTGACGTTTCTGCGCGTATTGCTGATATTCAGGAACGAATA
CGTCAAATTACAGCGCAGTGGTATGAGACGAAGATGAGTGACTTACAAACTGCTCCTGGGGTTAATAAGGCGCTA
CCATTGCTATTCATGACCGATGAGATTGAAAAGTACGGGAAATTATTGGATAAGAGATTTCCTGAACCTATATCT
GGGATCATTGATGTTGTTTCTATATATGTTGAGATTGCTGTACCGTATCTCGCCACGGACATGCAGAATCAACAA
AAGAAGCTGTTTGAGTCGTCAATGAATGGGCCAACCCCAGACGTACCGATTCAGGATATTTTTGCGTTATACAGG
CGGCTTAAGACGATGATGAGCATGTATGGCGCGTTCGTTCCGAGTGGTGATTTTGTCTTTGACGTGGCTAGTTTC
TTTGAGCCGTATGTTCGACAATGGCTTCTCAATACCGAAAGTAAAACCGAACAATGGGTCGAAGCTGCTATCGCA
GCGGACAAGTTCGAGGCGGAAGGGACTGAAGGACATAGTTCTTCCATCGTCGATCTTTTCGATTCCTTACGAAGT
CCAATCAATTTTTTGCAAGATCTGGAATGGACCGACCAGTATCAAGAAGCACGTTTCTTTACACATCTATCAAAG
AGCATATCAAACGCCGTAGAACAATATCGCCGCAGTGTTGAATCTCTCTTTTTAACAGAGATGTACCCCCGTCCA
ACCGACTACCTTCAACCTCAAAAATCATCCGCTTGGCTTGAGAAAGCTCGTCAATTAACAATCACAGGCGAAAAG
AAAGTCGAACCATTCAACTTCCGACCAGAATCTTGTGTCAAGCTAAACAATATCGAAGCTGCACGCAAATTGTTG
GATAAGATGTACGAGCAAATGCAAGCTGATAAAGTCTCGGATGTTTTGGCACATGCACCACCCGTACCGGAAAAG
GTTGAGAGGGATACGTTTTTATTTTCAGTGAAGATTGTTATTGCGGAGAATCTTGTGCCTTTGGATAGTAGTCCT
TCGAGTAGGTTGGATACGTTTGTGACGTTGAGTGATGAGAATGGGGTGAGGGTTGCGAAAACGAGGACGATTTAT
GAGTCTTTGGAGCCTAGATGGGAGGAGACGTTTGATATATCCGTAGAGAAGCCGCTTTGGTTAATGGTCAGTGTG
CGCGATAGAGCATTGGTCGGTAAACATGATATCGTCGGACGGGCTTATCTATGCCTTGACCCGCGACGTTTCGGA
GATCTGTTGGCGCATGAATTGTGGATGGATCTAGATACTCAGGGAAGGATATTGGTCAGGGTCAGTATGGAGGGA
GAGAAAGATGATATTCAGTTCTATTTCGGTCGAGCGTTCCGCTCATTGAAGAGAGCTGAAGCTGATATGTTGAGG
ATTTTCATCGACAAGATGTCACCATTCATCAATCAATGTCTATCTCGAAACGTCGTCAAGACACTTCTCAAATCT
AGAGAACAAGGCTTAGACTATAACAAAGCTCTTGGCAACGTGACAGCTTTCTATCGCTCTGCTGTTGGTGCTACT
TCTGCAGACCCACAGATACCTTTGCCGTCTTCGGAAAAGCCGCGTGTGCGACCTGAGGAACTCACGGATGTGGAA
ATTGAACAGGCGATATTACCCCTGTTTGATTATTTTGACGCGAATTTGCAGACGTTAAACACATATTTGAGTGAT
ACAGCGAAGGAGATGGTGATGACGAGGGTTTGGAAGGAGATTTTGACTGTTATTGAGGGATTGTTGATTCCTCCA
CTTTCGGATACGGCTATTGAGATGAAGCCGTTGAGCGACAAGGAAGTGGATATTGTGTTCAAGTGGCTCAAGTTC
TTGAGGGACTACTTCTATGCCGGAGGCGAAGGCCCAGTACCGCTCGAAACGTTACAGAACCAGAAGTATCGAGAT
GTTTTGTCAATACGACTTTACTATGATTGGCACACAGATGCGTTAATGGAGGAATGCGTGCGGATGATGCAGCAG
AATTTCCGACAGGCACCGACAATGAAGAAACGCGCTAAAAGTGTATATCAACAACGTAACCTGGGGACTATCAAG
GAGAGGAAGAAGGAAAAGAAGCAGGAACAAGAATCGACGAGCGAGCAAATCATAATGCGGATCTTGCGCATGAGA
CCGAGGACACAAGAGTTTATAGCTCAGCAAATGCAAATATCAGCCGCCATGCAAGCTGAACAGGAACAACGTGTG
CGAGAGACACAAGAGAGAAAGGCAAAACGGGCCGCTACAAGACCTTTGAGTCAGATTCCTCAGGTTCCTCCACTA
CCATAA
Gene >AgabiH97|033980
ATGTCTAGGCGGAGTTATGATGGTTCTGCCCACACCAGACGTCTCTCAAAACATCGTGTGAATGACGAGGAACTC
TTTGAGTATGTCTCTCGTGTTCGTCGTCTTTTTTTTGGATATTAATTGGCCTTTCGTAGCTATGTGCTACGTGTC
GCGTGAGCAGCTCTCTTTCGCTGAAATTCCTGCCATCCTGCTTGCTCACTCTCGCACCATTCAATCCTGGCTTGC
CGCCTTCGATCTTCTTTGGACTATCTCAGCCTACTCTCTCATGTCATTTCTCCCAAGCCCACGGATGCGCCACTA
GCTCAGCAAGAAGCGCGGGAGCGGGAGCGTGAGCATTCTTCCAGGCTATCGTCTCTTTCGAATTTTTCGTTGGGC
GACATGTTTGACAGCTTTCGGGATGGGTCAAAGAGCGTGAAATTCCCTGAAAAGTTGCTGAAGGTTTTGGATCAG
AGGTTGGAAAAAATTGGTATGAATCAGGATCCGGCGTACGTCTTGCCGTTCTTCTTCTTCCTCTTTCGTTCTTCT
GTTCTTCTCCTAATCTATCTGAATGCTGGCAACTGAGAGGAGCTTATTGTTCTAGATACTCTGATCAACTGGTCC
GAAGGACCATGACCAAGTTCTACGGTCAATTCTCAGTGACTACTTTCATGAAGCAGATGAAGGAAAGCCGAAAGA
TCGAAGACCTCATCCTGATGTTTGCAACTCACGCAACCAGTGTGCTCAAGAAAGAACCAACGCTGGCGGTTGGCG
ATGGCTGGAAGCTTGAACTCAACAACCAAATCGCACATTTCATTAAGCTACTCAGAGAATGTCTGAAGAACGTTC
ACCATGTGTCACCAGAATTACTGTCAAGGCTAGATGCGTACTCGGCAAAATTGACTCCAGCTACGGCCTACAGTG
ACTCCGGATATGAATCCAGTTCGACCTCTAGAGACAGGGATTCGGTCTATTCCAATTATGCAGTGACTAGTACGG
GAGTAGCAGATATGCCGCTAGTGAAGATGGTTGTCAAGTTGTTGAAGTTGAATGATCGGGATATACAGGCCGAGG
TAGATAAACTTAAGAATGGAACTGTGACAGACAAGGTATTTAAAAAGTTATATCGGGACTGAAAAATTGATCATC
CGTTGTTTAGGCTGCTGTTACGGATCTTAAGGTGCGCTGAACCTGGCAGCGATTGATTAAACGTTACACATAAAA
TACGCTTTTAGACCTGTTTGAAGAACATCAACGCTGGAGCAGCCTTTCCTGGTCGTCGAGAAGACTTTTCGAGTG
ACGCAGCATGGCAAAACTGGAAAACAATTGAAACTACACACCTACAACAACTCACAGTCGCCATGGTACAACTGA
ATCCCGAGCTTGCGAAAGCGACGTCGGCAGATGGTTACATGGCTAGTAGCTCAAGCTACTCGTCTCCAAGCTCAA
ACCGACCAGGATCCTTCTATGAAACGGCTTCAAGAGCAGGATCCATCAGTAGCAGACGATCAATTTACGACTCTC
AAAATGACATTTACGAACTTGAAGACGACCTTCCCGTAGGCCATCATTTCACATTCATTCCACCAAATCCCAAAA
AATATTACAAACGACTCGTGGAGTATTGTCTACGCGCGGATTTGGAAGTCATGTTGAGTCCAGAGGTGGATGATA
ACGATGAAGTTTCTTTAGGGATTCTGTCGCATCCTCATTTGGAATTGATCAACGAATGTGCGTTGAGATGGAGGA
TAGGACATCCTTATAGGGCGACGTGTTTCCTGGATTTGGTGAGACAGTTTTATGAGAGGAACGAGGTACCGATGG
AGTGTGTACCGGAAGCATTAGCGGGTGTGATAAAGGCGATGCAGGATACACCGTTGGATTATTGGATGCTTTCGG
ATGTGAGCTCTCCCTTTCACCTTCATACAAACCATCCAAAGCTAATGTTGGGAAACTCCGACTGGGCAGTCTGAT
TATCTTGTCAGCATCTATGGCAGTCTTTTTAACGTCTTTCTTTCCTCCTTATACCATGCGATGGACGCTATACCC
AATCTCAAACCTTCCGACATCGCTCCATATACCGATCTGTTGGAACAGTTACAAGATAGTGGATTATTGGAGCGT
ACTGATATTGACGTTTCTGCGCGTATTGCTGATATTCAGGAACGAATACGTCAAATTACAGCGCAGTGGTATGAG
ACGAAGATGAGTGACTTACAAACTGCTCCTGGGGTTAATAAGGCGCTACCATTGCTATTCATGACCGATGAGATT
GAAAAGTACGGGAAATTATTGGATAAGAGATTTCCTGAACCTATATCTGGGTACGTTTGCCGCTTATTTCCATTT
TTGTGCGGGCCAATCATTGACTGAGTTCGCTTTATTCAGGATCATTGATGTTGTTTCTATATATGTTGAGATTGC
TGTACCGTATCTCGCCACGGACATGCAGAATCAACAAAAGAAGCTGTTTGAGTCGTCAATGAATGGGCCAACCCC
AGACGTACCGATTCAGGATATTTTTGCGTTATACAGGCGGCTTAAGACGATGATGAGCATGTATGGCGCGTTCGT
TCCGAGGCACGTTGTTTCTTCCACGTACTTTTTGAATGGTTGATGACATTTGTGATATTATAGTGGTGATTTTGT
CTTTGACGTGGCTAGTTTCTTTGAGCCGTATGTTCGACAATGGCTTCTCAATACCGAAAGTAAAACCGAACAATG
GGTCGAAGCTGTACGTAGACTTCTTTGTGTATTGACGCTTGGAAATGTTGAGTTATTTTTTTTGTTTTGCTTAGG
CTATCGCAGCGGACAAGTTCGAGGCGGAAGGGACTGAAGGACATAGTTCTTCCATCGTCGATCTTTTCGATTCCT
TACGAAGTCCAATCAATTTTTTGCAAGATCTGGAATGGACCGACCAGTATCAAGAAGCACGTTTCTTTACACATC
TATCAAAGGTGCGCGCACATTCAACAGTGTTCAACTAGTGTCTGGGGGTGTTCATCCGAAATTGAAACAGAGCAT
ATCAAACGCCGTAGAACAATATCGCCGCAGTGTTGAATCTCTCTTTTTAACAGAGATGTACCCCCGTCCAACCGA
CTACCTTCAACCTCAAAAATCATCCGCTTGGCTTGAGAAAGCTCGTCAATTAACAATCACAGGCGAAAAGAAAGT
CGAACCATTCAACTTCCGACCAGAATCTTGTGTCAAGCTAAACAATATCGAAGCTGCACGCAAATTGTTGGATAA
GATGTACGAGCAAATGCAAGCTGATAAAGTCTCGGATGTTTTGGCACATGCACCACCCGTACCGGAAAAGGTTGA
GAGGGATACGTTTTTATTTTCAGTGAAGATTGTTATTGCGGAGAATCTTGTGCCTTTGGATAGTAGTCCTTCGAG
TAGGTTGGATACGTTTGTGACGTTGAGTGATGAGAATGGGGTGAGGGTTGCGAAAACGAGGACGATTTATGAGTC
TTTGGAGCCTAGATGTGAGTTTTGAATTCGAATCATTGTTTATTTTCTGATTCATTCCCTAATTTATCTGGTATG
TAGGGGAGGAGACGTTTGATATATCCGTAGAGAAGCCGCTTTGGTTAATGGTCAGTGTGCGCGATAGAGCATTGG
TCGGTAAACATGATATCGTCGGACGGGCTTATCTATGCCTTGACCCGCGACGTTTCGGAGATCTGTTGGCGCATG
AATTGTGGATGGATCTAGATACTCAGGGAAGGATATTGGTCAGGGTCAGTATGGAGGGAGAGAAAGATGATATTC
AGTTCTATTTCGGTCGAGCGTTCCGCTCATTGAAGAGAGCTGAAGCTGATATGTTGAGGATTTTCATCGACAAGG
TTAGTTTTTCATGTTCGACTATATCTTCTGTTAATGTTCACTTTGATAGATGTCACCATTCATCAATCAATGTCT
ATCTCGAAACGTCGTCAAGACACTTCTCAAATCTAGAGAACAAGGCTTAGACTATAACAAAGCTCTTGGCAACGT
GACAGCTTTCTATCGCTCTGCTGTTGGTGCTACTTCTGCAGACCCACAGATACCTTTGCCGTCTTCGGAAAAGCC
GCGTGTGCGACCTGAGGAACTCACGGATGTGGAAATTGAACAGGCGATATTACCCCTGTTTGATTATTTTGACGC
GAATTTGCAGACGTTAAACACATATTTGAGTGATACAGCGAAGGAGATGGTGATGACGAGGGTTTGGAAGGAGAT
TTTGACTGTTATTGAGGGATTGTTGATTCCTCCACTTTCGGATACGGCTATTGAGATGAAGCCGTTGAGCGACAA
GGAAGTGGATATTGTGTTCAAGTGGCTCAAGGTGAGTACTTCGTAAACAGTTAGCAGGCTTAGAGTTGATGATCG
TCTCAGTTCTTGAGGGACTACTTCTATGCCGGAGGCGAAGGCCCAGTACCGCTCGAAACGTTACAGAACCAGAAG
TATCGAGATGTTTTGTCAATACGACTTTACTATGATTGGCACACGTACGTCAATCTCATAGCCTTTTCTTTTCTG
AAAGTCCGAGTTGATGGGGGAACATACAGAGATGCGTTAATGGAGGAATGCGTGCGGATGATGCAGCAGAATTTC
CGACAGGCACCGACAATGAAGAAACGCGCTAAAAGTGTATATCAACAACGTAACCTGGGGACTATCAAGGAGAGG
AAGAAGGAAAAGAAGCAGGAACAAGAATCGACGAGCGAGCAAATCATAATGCGGATCTTGCGCATGAGGTGTGTG
TTGTTCTTCATCATGGTGATGTGTCCCCGTTGTAATGATTTCTCGCATGCGTAGACCGAGGACACAAGAGTTTAT
AGCTCAGCAAATGCAAATATCAGCCGCCATGCAAGCTGAACAGGAACAACGTGTGCGAGAGACACAAGAGAGAAA
GGCAAAACGGGCCGCTACAAGACCTTTGAGTCAGATTCCTCAGGTTCCTCCACTACCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail