Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|033950
Gene name
Locationscaffold_13:109333..112266
Strand+
Gene length (bp)2933
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 7.8E-76 22 728

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 6 828 1.0E-111
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 7 828 9.0E-108
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 21 842 5.0E-107
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 21 842 1.0E-106
sp|F4JMJ1|HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana GN=HSP70-17 PE=2 SV=1 15 841 2.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 6 828 1.0E-111
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 7 828 9.0E-108
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 21 842 5.0E-107
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 21 842 1.0E-106
sp|F4JMJ1|HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana GN=HSP70-17 PE=2 SV=1 15 841 2.0E-106
sp|Q60432|HYOU1_CRIGR Hypoxia up-regulated protein 1 OS=Cricetulus griseus GN=HYOU1 PE=2 SV=1 21 855 3.0E-106
sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens GN=HYOU1 PE=1 SV=1 21 842 5.0E-105
sp|Q566I3|HYOU1_XENLA Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus laevis GN=hyou1 PE=1 SV=2 6 555 5.0E-99
sp|Q0VA61|HYOU1_XENTR Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus tropicalis GN=hyou1 PE=2 SV=2 10 555 3.0E-98
sp|Q10061|LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.06 PE=3 SV=1 4 439 1.0E-95
sp|Q556U6|BIP1_DICDI Luminal-binding protein 1 OS=Dictyostelium discoideum GN=bip1-1 PE=3 SV=1 9 421 3.0E-66
sp|Q0IIM3|HS105_BOVIN Heat shock protein 105 kDa OS=Bos taurus GN=HSPH1 PE=2 SV=1 21 855 1.0E-61
sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens GN=HSPH1 PE=1 SV=1 21 855 1.0E-61
sp|Q5R606|HS105_PONAB Heat shock protein 105 kDa OS=Pongo abelii GN=HSPH1 PE=2 SV=1 21 855 2.0E-61
sp|Q61699|HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus GN=Hsph1 PE=1 SV=2 21 838 3.0E-60
sp|O88600|HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus GN=Hspa4 PE=1 SV=1 21 820 3.0E-59
sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens GN=HSPA4L PE=1 SV=3 125 867 1.0E-58
sp|Q2TFN9|HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris GN=HSPA4 PE=1 SV=1 21 820 2.0E-58
sp|P48722|HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus GN=Hspa4l PE=1 SV=2 125 864 6.0E-58
sp|Q5RDM4|HSP74_PONAB Heat shock 70 kDa protein 4 OS=Pongo abelii GN=HSPA4 PE=2 SV=1 21 820 3.0E-57
sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens GN=HSPA4 PE=1 SV=4 21 820 4.0E-57
sp|P36016|LHS1_YEAST Heat shock protein 70 homolog LHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHS1 PE=1 SV=1 3 450 5.0E-57
sp|Q60446|HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus GN=HSPH1 PE=2 SV=1 21 838 8.0E-57
sp|Q66HA8|HS105_RAT Heat shock protein 105 kDa OS=Rattus norvegicus GN=Hsph1 PE=1 SV=1 21 838 2.0E-56
sp|Q6FU50|LHS1_CANGA Heat shock protein 70 homolog LHS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LHS1 PE=3 SV=1 9 479 3.0E-56
sp|Q9SAB1|HSP7Q_ARATH Heat shock 70 kDa protein 16 OS=Arabidopsis thaliana GN=HSP70-16 PE=2 SV=1 21 849 9.0E-56
sp|Q61316|HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus GN=Hspa4 PE=1 SV=1 21 820 3.0E-55
sp|P32589|HSP7F_YEAST Heat shock protein homolog SSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE1 PE=1 SV=4 43 728 8.0E-51
sp|Q875P5|HSP7F_LACK1 Heat shock protein homolog SSE1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SSE1 PE=3 SV=1 43 728 1.0E-49
sp|Q6TMK3|HSP88_DICDI Heat shock protein 88 OS=Dictyostelium discoideum GN=hspH PE=1 SV=1 22 845 3.0E-49
sp|Q94738|HSP97_STRFN 97 kDa heat shock protein OS=Strongylocentrotus franciscanus GN=HSP110 PE=2 SV=1 21 820 4.0E-49
sp|Q875V0|HSP7F_NAUCC Heat shock protein homolog SSE1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SSE1 PE=3 SV=1 43 728 1.0E-47
sp|F4HQD4|HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana GN=HSP70-15 PE=1 SV=1 21 854 3.0E-47
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 21 473 3.0E-46
sp|Q9S7C0|HSP7O_ARATH Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana GN=HSP70-14 PE=2 SV=1 21 870 1.0E-45
sp|O59838|HSP7F_SCHPO Heat shock protein homolog pss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pss1 PE=1 SV=2 21 473 3.0E-45
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 19 424 4.0E-45
sp|Q74ZJ0|HSP7F_ASHGO Heat shock protein homolog SSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSE1 PE=3 SV=1 23 728 7.0E-45
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 20 466 8.0E-45
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 23 424 8.0E-45
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 20 441 2.0E-44
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 23 424 2.0E-44
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 20 466 4.0E-44
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 3 441 4.0E-44
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 20 421 4.0E-44
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 20 466 5.0E-44
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 23 424 6.0E-44
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 23 424 6.0E-44
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 23 424 6.0E-44
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 20 421 8.0E-44
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 20 466 9.0E-44
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 21 424 9.0E-44
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 23 424 1.0E-43
sp|Q6FJI3|HSP7F_CANGA Heat shock protein homolog SSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSE1 PE=3 SV=1 23 533 1.0E-43
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 23 424 2.0E-43
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 23 424 2.0E-43
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 11 524 2.0E-43
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 20 466 3.0E-43
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 20 419 3.0E-43
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 23 424 4.0E-43
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 20 421 5.0E-43
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 20 421 9.0E-43
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 23 466 1.0E-42
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 21 424 2.0E-42
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 21 424 2.0E-42
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 20 421 3.0E-42
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 23 424 4.0E-42
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 23 466 4.0E-42
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 17 424 7.0E-42
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 20 466 9.0E-42
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 17 424 9.0E-42
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 23 461 9.0E-42
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 4 421 1.0E-41
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 4 421 1.0E-41
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 4 421 1.0E-41
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 23 424 1.0E-41
sp|P32590|HSP79_YEAST Heat shock protein homolog SSE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE2 PE=1 SV=3 43 728 2.0E-41
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 17 424 2.0E-41
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 23 424 2.0E-41
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 23 461 3.0E-41
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 17 424 4.0E-41
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 23 461 4.0E-41
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 17 424 4.0E-41
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 20 441 4.0E-41
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 20 466 5.0E-41
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 23 424 5.0E-41
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 19 466 8.0E-41
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 16 424 9.0E-41
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 17 406 9.0E-41
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 19 424 1.0E-40
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 19 424 1.0E-40
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 19 424 1.0E-40
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 6 441 1.0E-40
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 19 461 1.0E-40
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 21 424 1.0E-40
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 23 461 1.0E-40
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 21 424 1.0E-40
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 21 424 2.0E-40
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 23 424 2.0E-40
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 23 424 2.0E-40
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 21 424 2.0E-40
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 23 461 2.0E-40
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 21 461 2.0E-40
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 21 461 2.0E-40
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 23 424 3.0E-40
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 23 461 3.0E-40
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 19 424 3.0E-40
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 19 424 4.0E-40
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 19 461 4.0E-40
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 23 461 6.0E-40
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 23 424 7.0E-40
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 23 424 8.0E-40
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 23 424 8.0E-40
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 20 424 8.0E-40
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 21 461 9.0E-40
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 21 461 1.0E-39
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 23 461 1.0E-39
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 18 424 2.0E-39
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 19 466 2.0E-39
sp|Q96VB9|HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSI3 PE=1 SV=2 43 473 2.0E-39
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 23 461 2.0E-39
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 23 461 2.0E-39
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 23 461 2.0E-39
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 16 424 2.0E-39
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 23 461 2.0E-39
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 23 461 2.0E-39
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 23 461 2.0E-39
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 16 424 3.0E-39
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 16 424 3.0E-39
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 20 406 3.0E-39
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 16 424 3.0E-39
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 23 461 3.0E-39
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 16 424 4.0E-39
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 23 461 5.0E-39
sp|Q03WI2|DNAK_LEUMM Chaperone protein DnaK OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dnaK PE=3 SV=1 22 410 5.0E-39
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 20 419 8.0E-39
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 23 461 8.0E-39
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 20 421 9.0E-39
sp|B1MZG6|DNAK_LEUCK Chaperone protein DnaK OS=Leuconostoc citreum (strain KM20) GN=dnaK PE=3 SV=1 22 410 9.0E-39
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 23 466 9.0E-39
sp|Q06068|HSP97_STRPU 97 kDa heat shock protein OS=Strongylocentrotus purpuratus PE=1 SV=2 21 475 1.0E-38
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 19 461 2.0E-38
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 23 406 2.0E-38
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 23 461 2.0E-38
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 19 466 2.0E-38
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 23 400 2.0E-38
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 23 461 2.0E-38
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 16 424 3.0E-38
sp|Q3IUI0|DNAK_NATPD Chaperone protein DnaK OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaK PE=3 SV=1 22 424 3.0E-38
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 19 424 4.0E-38
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 44 466 5.0E-38
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 19 461 8.0E-38
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 44 466 8.0E-38
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 23 461 8.0E-38
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 20 424 9.0E-38
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 23 406 9.0E-38
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 18 406 1.0E-37
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 20 461 1.0E-37
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 20 466 1.0E-37
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 23 461 1.0E-37
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 19 424 2.0E-37
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 20 420 2.0E-37
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 20 466 2.0E-37
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 9 466 2.0E-37
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 20 410 2.0E-37
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 19 424 2.0E-37
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 20 421 2.0E-37
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 20 421 2.0E-37
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 20 466 2.0E-37
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 20 466 2.0E-37
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 20 435 2.0E-37
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 20 420 3.0E-37
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 20 424 3.0E-37
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 21 424 3.0E-37
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 20 461 3.0E-37
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 20 461 3.0E-37
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 23 441 4.0E-37
sp|Q01100|DNAK_HALMA Chaperone protein DnaK OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaK PE=3 SV=2 22 424 4.0E-37
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 23 400 5.0E-37
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 20 466 6.0E-37
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 23 441 7.0E-37
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 19 424 7.0E-37
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 23 444 9.0E-37
sp|Q8EPW4|DNAK_OCEIH Chaperone protein DnaK OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaK PE=3 SV=1 22 434 1.0E-36
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 23 461 1.0E-36
sp|A8YVQ3|DNAK_LACH4 Chaperone protein DnaK OS=Lactobacillus helveticus (strain DPC 4571) GN=dnaK PE=3 SV=1 20 410 1.0E-36
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 22 410 1.0E-36
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 21 461 1.0E-36
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 17 424 1.0E-36
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 20 410 2.0E-36
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 16 466 2.0E-36
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 23 461 2.0E-36
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 23 400 2.0E-36
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 20 420 2.0E-36
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 20 410 2.0E-36
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 18 424 3.0E-36
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 22 410 3.0E-36
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 19 461 4.0E-36
sp|Q05647|DNAK_ERYRH Chaperone protein DnaK OS=Erysipelothrix rhusiopathiae GN=dnaK PE=3 SV=2 22 410 4.0E-36
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 19 466 4.0E-36
sp|Q84BU4|DNAK_LACAC Chaperone protein DnaK OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaK PE=3 SV=1 20 410 4.0E-36
sp|Q2RKX4|DNAK_MOOTA Chaperone protein DnaK OS=Moorella thermoacetica (strain ATCC 39073) GN=dnaK PE=3 SV=1 20 410 4.0E-36
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 23 443 4.0E-36
sp|Q044A9|DNAK_LACGA Chaperone protein DnaK OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaK PE=3 SV=1 20 410 5.0E-36
sp|Q74IT6|DNAK_LACJO Chaperone protein DnaK OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaK PE=3 SV=1 20 410 5.0E-36
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 23 400 5.0E-36
sp|Q6F149|DNAK_MESFL Chaperone protein DnaK OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=dnaK PE=3 SV=1 22 406 6.0E-36
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 20 466 7.0E-36
sp|Q1WUE8|DNAK_LACS1 Chaperone protein DnaK OS=Lactobacillus salivarius (strain UCC118) GN=dnaK PE=3 SV=1 20 410 7.0E-36
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 23 441 7.0E-36
sp|Q05036|YLA4_CAEEL Uncharacterized protein C30C11.4 OS=Caenorhabditis elegans GN=C30C11.4 PE=3 SV=1 21 822 8.0E-36
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 22 410 9.0E-36
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 22 410 9.0E-36
sp|Q9HRY2|DNAK_HALSA Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dnaK PE=3 SV=1 22 424 1.0E-35
sp|B0R3H4|DNAK_HALS3 Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dnaK PE=3 SV=1 22 424 1.0E-35
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 20 410 1.0E-35
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 23 461 1.0E-35
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 22 466 1.0E-35
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 20 410 2.0E-35
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 18 406 3.0E-35
sp|Q049W6|DNAK_LACDB Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaK PE=3 SV=1 20 410 3.0E-35
sp|Q1G9R2|DNAK_LACDA Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaK PE=3 SV=1 20 410 3.0E-35
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 23 408 3.0E-35
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 23 424 4.0E-35
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 20 476 4.0E-35
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 20 435 4.0E-35
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 125 410 5.0E-35
sp|Q9ZEJ0|DNAK_MYCHO Chaperone protein DnaK OS=Mycoplasma hominis GN=dnaK PE=3 SV=1 22 410 5.0E-35
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 23 424 6.0E-35
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 20 410 6.0E-35
sp|Q9KWS7|DNAK_GEOTM Chaperone protein DnaK OS=Geobacillus thermoglucosidasius GN=dnaK PE=3 SV=3 20 410 6.0E-35
sp|Q8KML6|DNAK_LACSN Chaperone protein DnaK OS=Lactobacillus sanfranciscensis GN=dnaK PE=3 SV=1 22 410 7.0E-35
sp|O86103|DNAK_AQUPY Chaperone protein DnaK (Fragment) OS=Aquifex pyrophilus GN=dnaK PE=3 SV=1 16 476 7.0E-35
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 23 424 8.0E-35
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 17 406 8.0E-35
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 23 461 8.0E-35
sp|C5C3P2|DNAK_BEUC1 Chaperone protein DnaK OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=dnaK PE=3 SV=1 20 424 8.0E-35
sp|P0A3J4|DNAK_STRAG Chaperone protein DnaK OS=Streptococcus agalactiae GN=dnaK PE=3 SV=1 22 410 9.0E-35
sp|P0A3J3|DNAK_STRA5 Chaperone protein DnaK OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaK PE=3 SV=1 22 410 9.0E-35
sp|P0A3J2|DNAK_STRA3 Chaperone protein DnaK OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaK PE=3 SV=1 22 410 9.0E-35
sp|Q3K3T2|DNAK_STRA1 Chaperone protein DnaK OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaK PE=3 SV=1 22 410 9.0E-35
sp|B5XHZ0|DNAK_STRPZ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 23 445 1.0E-34
sp|A6TSM0|DNAK_ALKMQ Chaperone protein DnaK OS=Alkaliphilus metalliredigens (strain QYMF) GN=dnaK PE=3 SV=1 20 410 1.0E-34
sp|P0DB71|DNAK_STRPQ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|P0DB70|DNAK_STRP3 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 18 406 1.0E-34
sp|Q1JFC8|DNAK_STRPD Chaperone protein DnaK OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 22 424 2.0E-34
sp|P0C0C5|DNAK_STRPY Chaperone protein DnaK OS=Streptococcus pyogenes GN=dnaK PE=3 SV=2 22 410 2.0E-34
sp|Q48RR3|DNAK_STRPM Chaperone protein DnaK OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|A2RCW6|DNAK_STRPG Chaperone protein DnaK OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|Q1J578|DNAK_STRPF Chaperone protein DnaK OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|P68837|DNAK_STRP8 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaK PE=3 SV=2 22 410 2.0E-34
sp|Q5XAD6|DNAK_STRP6 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaK PE=1 SV=3 22 410 2.0E-34
sp|P0C0C6|DNAK_STRP1 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M1 GN=dnaK PE=3 SV=2 22 410 2.0E-34
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 20 525 2.0E-34
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 20 415 2.0E-34
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 20 421 2.0E-34
sp|Q7VC04|DNAK1_PROMA Chaperone protein dnaK1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK1 PE=3 SV=1 22 424 2.0E-34
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 20 424 3.0E-34
sp|Q05558|DNAK_STRCO Chaperone protein DnaK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaK PE=3 SV=1 20 410 3.0E-34
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 20 424 3.0E-34
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 22 410 3.0E-34
sp|B9MJZ1|DNAK_CALBD Chaperone protein DnaK OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaK PE=3 SV=1 20 410 3.0E-34
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 20 410 4.0E-34
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 20 410 4.0E-34
sp|B9DVF3|DNAK_STRU0 Chaperone protein DnaK OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dnaK PE=3 SV=1 22 410 4.0E-34
sp|Q9RY23|DNAK_DEIRA Chaperone protein DnaK OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaK PE=1 SV=3 20 435 4.0E-34
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 22 410 5.0E-34
sp|Q03MR6|DNAK_STRTD Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dnaK PE=3 SV=1 22 410 5.0E-34
sp|Q5M1T8|DNAK_STRT1 Chaperone protein DnaK OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaK PE=3 SV=1 22 410 5.0E-34
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 22 410 5.0E-34
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 23 400 6.0E-34
sp|Q3AF08|DNAK_CARHZ Chaperone protein DnaK OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaK PE=3 SV=1 22 410 6.0E-34
sp|Q92BN8|DNAK_LISIN Chaperone protein DnaK OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaK PE=3 SV=3 20 410 6.0E-34
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 20 424 6.0E-34
sp|P0DJM2|DNAK_LISMO Chaperone protein DnaK OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaK PE=3 SV=1 20 410 6.0E-34
sp|G2K046|DNAK_LISM4 Chaperone protein DnaK OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaK PE=3 SV=1 20 410 6.0E-34
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 20 410 7.0E-34
sp|Q03FR7|DNAK_PEDPA Chaperone protein DnaK OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaK PE=3 SV=1 22 410 7.0E-34
sp|B8DE38|DNAK_LISMH Chaperone protein DnaK OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaK PE=3 SV=1 20 410 7.0E-34
sp|Q71ZJ7|DNAK_LISMF Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaK PE=3 SV=3 20 410 7.0E-34
sp|C1KVC0|DNAK_LISMC Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaK PE=3 SV=1 20 410 7.0E-34
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 22 410 8.0E-34
sp|C0M7T9|DNAK_STRE4 Chaperone protein DnaK OS=Streptococcus equi subsp. equi (strain 4047) GN=dnaK PE=3 SV=1 22 410 8.0E-34
sp|C1CCQ8|DNAK_STRZJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain JJA) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|P95829|DNAK_STRPN Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaK PE=3 SV=2 22 410 9.0E-34
sp|B8ZLY9|DNAK_STRPJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|B5E232|DNAK_STRP4 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 20 410 9.0E-34
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 23 445 9.0E-34
sp|C0ME86|DNAK_STRS7 Chaperone protein DnaK OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|C1CQ18|DNAK_STRZT Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|C1CJ06|DNAK_STRZP Chaperone protein DnaK OS=Streptococcus pneumoniae (strain P1031) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|Q8CWT3|DNAK_STRR6 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|B1IA52|DNAK_STRPI Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|C1C5N7|DNAK_STRP7 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain 70585) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|Q04LY0|DNAK_STRP2 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|Q9ZEJ6|DNAK1_NOSS1 Chaperone protein dnaK1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK1 PE=3 SV=2 20 410 1.0E-33
sp|B9E6X1|DNAK_MACCJ Chaperone protein DnaK OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|B8DYH6|DNAK_DICTD Chaperone protein DnaK OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=dnaK PE=3 SV=1 20 424 1.0E-33
sp|B2IMB5|DNAK_STRPS Chaperone protein DnaK OS=Streptococcus pneumoniae (strain CGSP14) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 23 445 1.0E-33
sp|A8GMF9|DNAK_RICAH Chaperone protein DnaK OS=Rickettsia akari (strain Hartford) GN=dnaK PE=3 SV=1 22 424 1.0E-33
sp|B9LUC7|DNAK_HALLT Chaperone protein DnaK OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaK PE=3 SV=1 22 424 1.0E-33
sp|A4XKA4|DNAK_CALS8 Chaperone protein DnaK OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaK PE=3 SV=1 20 410 1.0E-33
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 20 424 1.0E-33
sp|O05714|DNAK_ANAVT Chaperone protein DnaK OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaK PE=3 SV=1 20 410 1.0E-33
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 23 445 1.0E-33
sp|Q826F6|DNAK2_STRAW Chaperone protein dnaK2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK2 PE=3 SV=1 20 410 2.0E-33
sp|Q5M6D1|DNAK_STRT2 Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaK PE=3 SV=1 22 410 2.0E-33
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 20 410 2.0E-33
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 20 405 2.0E-33
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 23 410 2.0E-33
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 23 410 2.0E-33
sp|O87777|DNAK_LACSK Chaperone protein DnaK OS=Lactobacillus sakei GN=dnaK PE=2 SV=1 20 410 2.0E-33
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 23 400 2.0E-33
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|P50022|DNAK3_SYNE7 Chaperone protein dnaK3 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK3 PE=3 SV=1 20 424 2.0E-33
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 23 410 3.0E-33
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 20 410 3.0E-33
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 20 476 3.0E-33
sp|B1HUD1|DNAK_LYSSC Chaperone protein DnaK OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 20 405 3.0E-33
sp|Q31HA7|DNAK_THICR Chaperone protein DnaK OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaK PE=3 SV=1 22 424 3.0E-33
sp|P29215|DNAK_GUITH Chaperone protein dnaK OS=Guillardia theta GN=dnaK PE=3 SV=2 22 476 3.0E-33
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|P05646|DNAK_BACME Chaperone protein DnaK OS=Bacillus megaterium GN=dnaK PE=3 SV=3 20 410 3.0E-33
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 22 424 3.0E-33
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 22 410 3.0E-33
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|Q1JKD6|DNAK_STRPC Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|Q1JA83|DNAK_STRPB Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 22 406 4.0E-33
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 20 476 4.0E-33
sp|Q38W93|DNAK_LACSS Chaperone protein DnaK OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaK PE=3 SV=1 20 410 4.0E-33
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 20 476 4.0E-33
sp|Q65H54|DNAK_BACLD Chaperone protein DnaK OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaK PE=3 SV=1 22 410 5.0E-33
sp|Q6B8V2|DNAK_GRATL Chaperone protein dnaK OS=Gracilaria tenuistipitata var. liui GN=dnaK PE=3 SV=1 20 410 5.0E-33
sp|Q5N1V0|DNAK1_SYNP6 Chaperone protein DnaK 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK1 PE=3 SV=1 20 424 5.0E-33
sp|Q8EUH7|DNAK_MYCPE Chaperone protein DnaK OS=Mycoplasma penetrans (strain HF-2) GN=dnaK PE=3 SV=1 1 435 6.0E-33
sp|Q7U6R7|DNAK1_SYNPX Chaperone protein dnaK1 OS=Synechococcus sp. (strain WH8102) GN=dnaK1 PE=3 SV=1 22 424 6.0E-33
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 22 410 6.0E-33
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 22 406 7.0E-33
sp|A9WQR3|DNAK_RENSM Chaperone protein DnaK OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=dnaK PE=3 SV=1 23 410 7.0E-33
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 20 410 7.0E-33
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 17 406 7.0E-33
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 20 405 8.0E-33
sp|Q4A658|DNAK_MYCS5 Chaperone protein DnaK OS=Mycoplasma synoviae (strain 53) GN=dnaK PE=3 SV=1 22 409 8.0E-33
sp|B8H6Q1|DNAK_ARTCA Chaperone protein DnaK OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=dnaK PE=3 SV=1 23 410 9.0E-33
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 22 410 9.0E-33
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 20 405 9.0E-33
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 22 406 9.0E-33
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 22 406 9.0E-33
sp|Q9HHB9|DNAK_HALMT Chaperone protein DnaK OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaK PE=3 SV=1 22 424 9.0E-33
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 20 410 1.0E-32
sp|A8AVA8|DNAK_STRGC Chaperone protein DnaK OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dnaK PE=3 SV=1 22 410 1.0E-32
sp|A0K1L3|DNAK_ARTS2 Chaperone protein DnaK OS=Arthrobacter sp. (strain FB24) GN=dnaK PE=3 SV=1 23 410 1.0E-32
sp|O06942|DNAK_STRMU Chaperone protein DnaK OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaK PE=2 SV=2 22 410 1.0E-32
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 22 410 2.0E-32
sp|Q03QU1|DNAK_LACBA Chaperone protein DnaK OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|P47547|DNAK_MYCGE Chaperone protein DnaK OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|A4X148|DNAK_SALTO Chaperone protein DnaK OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|Q88VM0|DNAK_LACPL Chaperone protein DnaK OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaK PE=3 SV=1 112 410 2.0E-32
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|P48741|HSP77_HUMAN Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2 23 369 2.0E-32
sp|Q82EX9|DNAK1_STRAW Chaperone protein dnaK1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK1 PE=3 SV=1 20 410 2.0E-32
sp|B5YAR3|DNAK_DICT6 Chaperone protein DnaK OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|C0ZB48|DNAK_BREBN Chaperone protein DnaK OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|P26823|DNAK_CLOPE Chaperone protein DnaK OS=Clostridium perfringens (strain 13 / Type A) GN=dnaK PE=3 SV=2 22 410 2.0E-32
sp|Q0TNS7|DNAK_CLOP1 Chaperone protein DnaK OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|Q07US6|DNAK_RHOP5 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 23 466 2.0E-32
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|Q21CI2|DNAK_RHOPB Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|Q6MT06|DNAK_MYCMS Chaperone protein DnaK OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaK PE=3 SV=1 22 406 3.0E-32
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 125 410 3.0E-32
sp|Q0SRE3|DNAK_CLOPS Chaperone protein DnaK OS=Clostridium perfringens (strain SM101 / Type A) GN=dnaK PE=3 SV=1 22 410 3.0E-32
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|B0S1F8|DNAK_FINM2 Chaperone protein DnaK OS=Finegoldia magna (strain ATCC 29328) GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 22 474 3.0E-32
sp|Q12WE6|DNAK_METBU Chaperone protein DnaK OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dnaK PE=3 SV=1 22 424 3.0E-32
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 20 424 3.0E-32
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|Q2SSB0|DNAK_MYCCT Chaperone protein DnaK OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaK PE=3 SV=1 22 406 3.0E-32
sp|Q54215|DNAK_STRGR Chaperone protein DnaK OS=Streptomyces griseus GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|Q2J320|DNAK_RHOP2 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=3 SV=1 22 424 3.0E-32
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 23 408 3.0E-32
sp|A4VT29|DNAK_STRSY Chaperone protein DnaK OS=Streptococcus suis (strain 05ZYH33) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|A4VZB5|DNAK_STRS2 Chaperone protein DnaK OS=Streptococcus suis (strain 98HAH33) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|Q8G6W1|DNAK_BIFLO Chaperone protein DnaK OS=Bifidobacterium longum (strain NCC 2705) GN=dnaK PE=3 SV=1 20 400 4.0E-32
sp|B3DNP9|DNAK_BIFLD Chaperone protein DnaK OS=Bifidobacterium longum (strain DJO10A) GN=dnaK PE=3 SV=1 20 400 4.0E-32
sp|Q3BVB8|DNAK_XANC5 Chaperone protein DnaK OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|Q1QRU1|DNAK_NITHX Chaperone protein DnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=3 SV=1 20 424 4.0E-32
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 20 406 4.0E-32
sp|B5ZBE9|DNAK_UREU1 Chaperone protein DnaK OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=dnaK PE=3 SV=1 22 474 4.0E-32
sp|Q8PMB0|DNAK_XANAC Chaperone protein DnaK OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|P20583|HSP71_TRYCR Heat shock 70 kDa protein, mitochondrial OS=Trypanosoma cruzi GN=MTP70 PE=3 SV=1 18 461 5.0E-32
sp|B1VMF3|DNAK_STRGG Chaperone protein DnaK OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=dnaK PE=3 SV=1 20 410 5.0E-32
sp|A3CQC2|DNAK_STRSV Chaperone protein DnaK OS=Streptococcus sanguinis (strain SK36) GN=dnaK PE=3 SV=1 22 410 5.0E-32
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 20 525 5.0E-32
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 20 525 5.0E-32
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 20 525 5.0E-32
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 22 410 5.0E-32
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 22 410 5.0E-32
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 20 525 6.0E-32
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 22 435 6.0E-32
sp|Q87RX3|DNAK_VIBPA Chaperone protein DnaK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaK PE=3 SV=1 20 410 6.0E-32
sp|A7MWW0|DNAK_VIBCB Chaperone protein DnaK OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaK PE=3 SV=1 20 410 6.0E-32
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 22 435 7.0E-32
sp|Q72IK5|DNAK_THET2 Chaperone protein DnaK OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaK PE=3 SV=1 20 461 7.0E-32
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 22 410 7.0E-32
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 22 410 7.0E-32
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 20 424 7.0E-32
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 22 474 8.0E-32
sp|Q6KIH7|DNAK_MYCMO Chaperone protein DnaK OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaK PE=3 SV=1 22 424 8.0E-32
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 20 525 9.0E-32
sp|B7GT47|DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=dnaK PE=3 SV=1 20 400 9.0E-32
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 22 410 9.0E-32
sp|C4K3I6|DNAK_HAMD5 Chaperone protein DnaK OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|Q56235|DNAK_THET8 Chaperone protein DnaK OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaK PE=3 SV=2 20 461 1.0E-31
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 22 525 1.0E-31
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 22 525 1.0E-31
sp|A4IX28|DNAK_FRATW Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|B1YKS9|DNAK_EXIS2 Chaperone protein DnaK OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaK PE=3 SV=1 20 410 1.0E-31
sp|Q8PAK9|DNAK_XANCP Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|B0RVU2|DNAK_XANCB Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|Q4UT11|DNAK_XANC8 Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|Q13E60|DNAK_RHOPS Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=3 SV=1 22 424 1.0E-31
sp|Q1IT15|DNAK_KORVE Chaperone protein DnaK OS=Koribacter versatilis (strain Ellin345) GN=dnaK PE=3 SV=1 20 461 1.0E-31
sp|A9KKU0|DNAK_CLOPH Chaperone protein DnaK OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaK PE=3 SV=1 22 424 1.0E-31
sp|A3M8W9|DNAK_ACIBT Chaperone protein DnaK OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaK PE=3 SV=2 20 406 1.0E-31
sp|B2HZZ7|DNAK_ACIBC Chaperone protein DnaK OS=Acinetobacter baumannii (strain ACICU) GN=dnaK PE=3 SV=1 20 406 1.0E-31
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 20 405 2.0E-31
sp|Q1IF59|DNAK_PSEE4 Chaperone protein DnaK OS=Pseudomonas entomophila (strain L48) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|B0V5U4|DNAK_ACIBY Chaperone protein DnaK OS=Acinetobacter baumannii (strain AYE) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|B7IBK5|DNAK_ACIB5 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB0057) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|B7H317|DNAK_ACIB3 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 22 424 2.0E-31
sp|B8FUN4|DNAK_DESHD Chaperone protein DnaK OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|Q67S54|DNAK_SYMTH Chaperone protein DnaK OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 22 420 2.0E-31
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 20 424 2.0E-31
sp|P48205|DNAK_FRATU Chaperone protein DnaK OS=Francisella tularensis GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|B2SQU4|DNAK_XANOP Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q2P459|DNAK_XANOM Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 20 424 2.0E-31
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|Q5H186|DNAK_XANOR Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 20 405 2.0E-31
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 20 424 2.0E-31
sp|Q5NFG7|DNAK_FRATT Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q14GW9|DNAK_FRAT1 Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|A1A3P5|DNAK_BIFAA Chaperone protein DnaK OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=dnaK PE=3 SV=1 23 400 3.0E-31
sp|A0Q7F0|DNAK_FRATN Chaperone protein DnaK OS=Francisella tularensis subsp. novicida (strain U112) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 22 482 3.0E-31
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 22 410 3.0E-31
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|Q0BLK4|DNAK_FRATO Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dnaK PE=3 SV=1 22 410 4.0E-31
sp|Q2A328|DNAK_FRATH Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaK PE=3 SV=1 22 410 4.0E-31
sp|A7NCM9|DNAK_FRATF Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dnaK PE=3 SV=1 22 410 4.0E-31
sp|Q4A8U5|DNAK_MYCH7 Chaperone protein DnaK OS=Mycoplasma hyopneumoniae (strain 7448) GN=dnaK PE=3 SV=1 22 409 4.0E-31
sp|Q9PQF2|DNAK_UREPA Chaperone protein DnaK OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaK PE=3 SV=1 22 474 4.0E-31
sp|B1AIX8|DNAK_UREP2 Chaperone protein DnaK OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=dnaK PE=3 SV=1 22 474 4.0E-31
sp|A0LWS7|DNAK_ACIC1 Chaperone protein DnaK OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=dnaK PE=3 SV=1 20 410 4.0E-31
sp|P73098|DNAK3_SYNY3 Chaperone protein dnaK3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK3 PE=3 SV=2 20 410 4.0E-31
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 22 406 4.0E-31
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 22 410 4.0E-31
sp|A8LWM4|DNAK_SALAI Chaperone protein DnaK OS=Salinispora arenicola (strain CNS-205) GN=dnaK PE=3 SV=1 20 410 5.0E-31
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 22 410 5.0E-31
sp|A6LRN4|DNAK_CLOB8 Chaperone protein DnaK OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaK PE=3 SV=1 22 435 5.0E-31
sp|Q5UPU0|HSP7L_MIMIV Heat shock protein 70 homolog OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L254 PE=3 SV=1 22 526 5.0E-31
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 20 424 5.0E-31
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 22 406 5.0E-31
sp|Q556U6|BIP1_DICDI Luminal-binding protein 1 OS=Dictyostelium discoideum GN=bip1-1 PE=3 SV=1 609 707 2.0E-06
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 636 739 2.0E-06
sp|Q10061|LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.06 PE=3 SV=1 645 866 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0140657 ATP-dependent activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0044183 protein folding chaperone No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|033950
MRLTRVWSALALLAPLAVEASVLAIDYGADYMKASLMKPGTPFDVLLNKDSKRKIQSVVGWKKSDRVFGGDAFNL
ASRFPSDVFIDTKILQAVPYDSDTVSFYKKISSADVIESSRGAVAFKQSDEKEWTVEELVAMQLAYVKDLAESFA
QEKVRDVVVAVPPYYTQFERDAIVDAIEISGLKTLALINDGTAVAVNYAMTRTFDEAPEYHIFYDAGASSIAATV
VAFSSTTDKKEGAGTQVSVAGVGWDRNVAGLELDRRLREILVRAFEEKHHKSLRQDKKGMTKLWKEASRVKSILS
ANSEATSSVESLAYNIDFKTKVTRAAFEEACKDLQPRFVQPIFDALLSAGLSMNDISSVVFTGGATRTPMVQAAV
KKVVGEDKMAFNVNADESIVLGAALYGASLSRQFKTKNIKVNDLTVYDLQASYAAAPTSPDAKPRTITTLVFPAG
SKTGTKKTLTFKRKEDFTINLDYRDLGDSGFPSRMLEADIVGVAEAIANLTERGAIDPVVKATLTLSESGFFSVS
DAVAFGEIKDDSITGKLKGLFAGSSSADETSTGSAENTPPRETPETAETVSPSSSSSASSSADTPEPTTKVEEEK
KKAPVENTIPLTVNVRFTTISPMTVEEKQQSRKKLRAVDQEEAIKTRREEARNTFESYLYRLRDLLDDESAETPF
KKCSRETEREALATRLDESFQWLFDRGDIADTTHFLDKRIALETLEKPIIHRYKEIEAFPEALNNSQKWNFHTRI
FLTEARQNLTLESEAGLPSKWTSEELDGLEKTLKDHEKWLNEWVEKQRSVKSFEDPVIETMEMKARAKTLETQLF
KLVKRKVPKTKKPVKKDEPEASGTSSVKEDAKSTTTTTPTSTTTPDMKEEEKNGDDSRTRDEL*
Coding >AgabiH97|033950
ATGCGATTAACACGAGTTTGGAGTGCTCTGGCCCTCCTTGCACCTCTAGCCGTAGAAGCCTCCGTACTCGCTATC
GACTATGGCGCGGATTACATGAAGGCATCATTGATGAAGCCTGGCACACCGTTCGACGTCCTCTTGAACAAGGAC
TCGAAGAGAAAAATTCAGTCTGTTGTAGGCTGGAAGAAGTCGGATCGGGTATTTGGTGGTGACGCATTCAACCTC
GCATCGAGATTTCCTAGTGACGTCTTCATCGACACCAAAATACTTCAGGCCGTCCCATACGACTCTGACACCGTT
TCTTTCTATAAGAAAATATCCAGTGCAGACGTGATAGAGAGTTCTCGTGGAGCTGTTGCTTTTAAACAGAGCGAC
GAAAAAGAATGGACAGTCGAAGAACTCGTCGCCATGCAACTTGCCTATGTCAAGGACCTCGCAGAGTCATTTGCT
CAGGAAAAAGTCCGAGACGTTGTCGTGGCTGTCCCCCCATACTATACACAATTCGAGCGTGATGCCATCGTCGAC
GCTATCGAGATTTCCGGTCTGAAGACACTTGCTCTTATTAATGATGGAACGGCAGTAGCCGTCAACTACGCTATG
ACGAGGACCTTCGATGAAGCACCAGAGTACCACATCTTCTATGACGCTGGAGCATCGTCAATTGCCGCGACCGTT
GTTGCGTTCTCAAGTACAACCGATAAAAAGGAAGGTGCTGGCACTCAAGTATCCGTCGCTGGCGTTGGCTGGGAT
CGTAATGTCGCCGGATTGGAGTTGGATAGGCGGCTAAGGGAGATTTTGGTCCGGGCTTTCGAAGAGAAGCATCAC
AAGAGTCTGCGGCAGGACAAGAAGGGTATGACGAAGCTTTGGAAAGAAGCAAGTCGTGTCAAAAGCATCCTCAGC
GCCAACTCAGAGGCCACTTCCTCGGTGGAATCTCTGGCCTACAATATCGATTTCAAGACCAAAGTCACTCGGGCG
GCATTTGAAGAAGCATGTAAAGATCTTCAACCCCGTTTCGTTCAGCCAATCTTCGACGCGCTCCTTTCTGCTGGG
CTCAGTATGAATGACATTTCGTCTGTGGTCTTCACTGGTGGAGCCACGAGAACGCCTATGGTTCAAGCCGCCGTC
AAAAAAGTTGTTGGCGAGGATAAAATGGCTTTCAACGTGAACGCGGATGAATCGATAGTGTTGGGTGCGGCCCTA
TATGGTGCTTCGCTCAGCCGGCAGTTCAAGACCAAGAACATTAAGGTCAACGATCTCACCGTGTATGACCTTCAG
GCATCGTATGCTGCTGCTCCAACTTCACCTGACGCGAAACCGAGAACTATAACGACTCTCGTATTCCCCGCTGGA
TCCAAAACCGGTACCAAGAAGACATTGACCTTTAAGAGGAAGGAAGATTTTACCATTAATCTCGATTATCGTGAC
CTTGGTGACTCGGGTTTCCCTTCTCGTATGCTGGAGGCCGATATTGTTGGCGTTGCTGAGGCTATCGCGAACCTC
ACTGAGCGCGGAGCAATCGATCCTGTCGTCAAAGCAACTCTTACACTCTCCGAATCTGGCTTTTTCAGTGTTTCC
GATGCTGTCGCCTTTGGCGAAATCAAGGATGATAGTATCACTGGAAAGTTAAAGGGACTCTTCGCTGGAAGCAGC
TCAGCAGACGAAACGTCTACTGGATCTGCGGAAAATACGCCACCTAGGGAGACTCCTGAAACCGCGGAAACTGTT
TCTCCATCCTCGTCATCATCAGCGTCGTCATCAGCTGATACTCCCGAGCCTACTACCAAGGTGGAGGAAGAAAAG
AAGAAGGCTCCTGTCGAAAATACAATCCCCCTCACTGTCAATGTCAGGTTTACGACAATATCTCCAATGACCGTC
GAGGAGAAACAACAGTCCAGGAAAAAGCTTCGTGCTGTTGACCAAGAAGAAGCTATCAAGACTCGCCGCGAAGAA
GCTCGTAATACTTTCGAGAGCTACCTTTACCGTCTTCGCGATCTTTTGGATGACGAAAGTGCCGAGACGCCGTTC
AAGAAATGTTCAAGAGAAACCGAACGCGAGGCCCTCGCTACCCGGCTGGATGAATCCTTCCAATGGCTCTTCGAC
CGTGGTGATATAGCCGACACGACTCATTTCCTCGATAAACGTATAGCACTCGAAACGCTCGAGAAACCAATCATT
CATCGTTACAAAGAAATCGAAGCCTTCCCAGAAGCGTTAAACAACTCCCAAAAATGGAATTTCCATACCCGTATA
TTCTTAACCGAAGCTAGGCAAAATCTTACTCTCGAATCTGAAGCCGGTTTACCCTCGAAATGGACTTCCGAAGAA
CTTGATGGTCTAGAGAAGACTTTGAAAGATCATGAGAAGTGGTTGAATGAGTGGGTAGAAAAACAGCGCTCTGTG
AAGAGTTTTGAGGATCCTGTTATTGAAACTATGGAGATGAAAGCTAGAGCCAAAACTTTGGAAACGCAGTTGTTC
AAGTTGGTGAAGAGGAAGGTGCCGAAGACGAAGAAGCCAGTGAAGAAGGATGAACCGGAGGCGAGTGGTACCAGT
AGTGTGAAAGAGGATGCGAAATCCACTACTACTACGACGCCTACATCGACAACGACACCAGATATGAAGGAGGAG
GAGAAGAATGGTGATGATTCGAGGACGCGTGATGAACTGTAG
Transcript >AgabiH97|033950
ATGCGATTAACACGAGTTTGGAGTGCTCTGGCCCTCCTTGCACCTCTAGCCGTAGAAGCCTCCGTACTCGCTATC
GACTATGGCGCGGATTACATGAAGGCATCATTGATGAAGCCTGGCACACCGTTCGACGTCCTCTTGAACAAGGAC
TCGAAGAGAAAAATTCAGTCTGTTGTAGGCTGGAAGAAGTCGGATCGGGTATTTGGTGGTGACGCATTCAACCTC
GCATCGAGATTTCCTAGTGACGTCTTCATCGACACCAAAATACTTCAGGCCGTCCCATACGACTCTGACACCGTT
TCTTTCTATAAGAAAATATCCAGTGCAGACGTGATAGAGAGTTCTCGTGGAGCTGTTGCTTTTAAACAGAGCGAC
GAAAAAGAATGGACAGTCGAAGAACTCGTCGCCATGCAACTTGCCTATGTCAAGGACCTCGCAGAGTCATTTGCT
CAGGAAAAAGTCCGAGACGTTGTCGTGGCTGTCCCCCCATACTATACACAATTCGAGCGTGATGCCATCGTCGAC
GCTATCGAGATTTCCGGTCTGAAGACACTTGCTCTTATTAATGATGGAACGGCAGTAGCCGTCAACTACGCTATG
ACGAGGACCTTCGATGAAGCACCAGAGTACCACATCTTCTATGACGCTGGAGCATCGTCAATTGCCGCGACCGTT
GTTGCGTTCTCAAGTACAACCGATAAAAAGGAAGGTGCTGGCACTCAAGTATCCGTCGCTGGCGTTGGCTGGGAT
CGTAATGTCGCCGGATTGGAGTTGGATAGGCGGCTAAGGGAGATTTTGGTCCGGGCTTTCGAAGAGAAGCATCAC
AAGAGTCTGCGGCAGGACAAGAAGGGTATGACGAAGCTTTGGAAAGAAGCAAGTCGTGTCAAAAGCATCCTCAGC
GCCAACTCAGAGGCCACTTCCTCGGTGGAATCTCTGGCCTACAATATCGATTTCAAGACCAAAGTCACTCGGGCG
GCATTTGAAGAAGCATGTAAAGATCTTCAACCCCGTTTCGTTCAGCCAATCTTCGACGCGCTCCTTTCTGCTGGG
CTCAGTATGAATGACATTTCGTCTGTGGTCTTCACTGGTGGAGCCACGAGAACGCCTATGGTTCAAGCCGCCGTC
AAAAAAGTTGTTGGCGAGGATAAAATGGCTTTCAACGTGAACGCGGATGAATCGATAGTGTTGGGTGCGGCCCTA
TATGGTGCTTCGCTCAGCCGGCAGTTCAAGACCAAGAACATTAAGGTCAACGATCTCACCGTGTATGACCTTCAG
GCATCGTATGCTGCTGCTCCAACTTCACCTGACGCGAAACCGAGAACTATAACGACTCTCGTATTCCCCGCTGGA
TCCAAAACCGGTACCAAGAAGACATTGACCTTTAAGAGGAAGGAAGATTTTACCATTAATCTCGATTATCGTGAC
CTTGGTGACTCGGGTTTCCCTTCTCGTATGCTGGAGGCCGATATTGTTGGCGTTGCTGAGGCTATCGCGAACCTC
ACTGAGCGCGGAGCAATCGATCCTGTCGTCAAAGCAACTCTTACACTCTCCGAATCTGGCTTTTTCAGTGTTTCC
GATGCTGTCGCCTTTGGCGAAATCAAGGATGATAGTATCACTGGAAAGTTAAAGGGACTCTTCGCTGGAAGCAGC
TCAGCAGACGAAACGTCTACTGGATCTGCGGAAAATACGCCACCTAGGGAGACTCCTGAAACCGCGGAAACTGTT
TCTCCATCCTCGTCATCATCAGCGTCGTCATCAGCTGATACTCCCGAGCCTACTACCAAGGTGGAGGAAGAAAAG
AAGAAGGCTCCTGTCGAAAATACAATCCCCCTCACTGTCAATGTCAGGTTTACGACAATATCTCCAATGACCGTC
GAGGAGAAACAACAGTCCAGGAAAAAGCTTCGTGCTGTTGACCAAGAAGAAGCTATCAAGACTCGCCGCGAAGAA
GCTCGTAATACTTTCGAGAGCTACCTTTACCGTCTTCGCGATCTTTTGGATGACGAAAGTGCCGAGACGCCGTTC
AAGAAATGTTCAAGAGAAACCGAACGCGAGGCCCTCGCTACCCGGCTGGATGAATCCTTCCAATGGCTCTTCGAC
CGTGGTGATATAGCCGACACGACTCATTTCCTCGATAAACGTATAGCACTCGAAACGCTCGAGAAACCAATCATT
CATCGTTACAAAGAAATCGAAGCCTTCCCAGAAGCGTTAAACAACTCCCAAAAATGGAATTTCCATACCCGTATA
TTCTTAACCGAAGCTAGGCAAAATCTTACTCTCGAATCTGAAGCCGGTTTACCCTCGAAATGGACTTCCGAAGAA
CTTGATGGTCTAGAGAAGACTTTGAAAGATCATGAGAAGTGGTTGAATGAGTGGGTAGAAAAACAGCGCTCTGTG
AAGAGTTTTGAGGATCCTGTTATTGAAACTATGGAGATGAAAGCTAGAGCCAAAACTTTGGAAACGCAGTTGTTC
AAGTTGGTGAAGAGGAAGGTGCCGAAGACGAAGAAGCCAGTGAAGAAGGATGAACCGGAGGCGAGTGGTACCAGT
AGTGTGAAAGAGGATGCGAAATCCACTACTACTACGACGCCTACATCGACAACGACACCAGATATGAAGGAGGAG
GAGAAGAATGGTGATGATTCGAGGACGCGTGATGAACTGTAG
Gene >AgabiH97|033950
ATGCGATTAACACGAGTTTGGAGTGCTCTGGCCCTCCTTGCACCTCTAGCCGTAGAAGCCTCCGTACTCGCTATC
GACTATGGCGCGGATTACATGAAGGCATCATTGATGAAGCCTGGCACACCGTTCGACGTCCTCTTGAACAAGGAC
TCGAAGAGAAAAATTCAGTCTGTTGTAGGCTGGAAGAAGTCGGATCGGGTATTTGGTGGTGACGCATTCAACCTC
GTACGCCTCTTCTCTCCCCTTTATCATTTATTTAGTAAATAAGCTTATTATAGGCATCGAGATTTCCTAGTGACG
TCTTCATCGACACCAAAATACTTCAGGCCGTCCCATACGACTCTGACACCGTTTCTTTCTATAAGAAAATATCCA
GTGCAGACGTGATAGAGAGTTCTCGTGGAGCTGTTGCTTTTAAACAGAGCGACGAAAAAGAATGGACAGTCGAAG
AACTCGTCGCCATGCAACTTGCCTATGTCAAGGACCTCGCAGAGTCATTTGCTCAGGAAAAAGTCCGAGACGTTG
TCGTGGCTGTCCCCCCATACTATACACAATTCGAGCGTGATGCCATCGTCGACGCTATCGAGATTTCCGGTCTGA
AGACACTTGCTCTTATTAATGATGGAACGGCAGTAGCCGTCAACTACGCTATGACGAGGACCTTCGATGAAGCAC
CAGAGTACCACATCTTCTATGACGCTGGAGCATCGTCAATTGCCGCGACCGTTGTTGCGTTCTCAAGTACAACCG
ATAAAAAGGAAGGTGCTGGCACTCAAGTATCCGTCGCTGGCGTTGGCTGGGATCGTAATGTCGCCGGATTGGAGT
TGGATAGGCGGCTAAGGGAGATTTTGGTCCGGGCTTTCGAAGAGAAGCATCACAAGAGTCTGCGGCAGGACAAGA
AGGGTATGACGAAGCTTTGGAAAGAAGCAAGTCGTGTCAAAAGCATCCTCAGCGCCAACTCAGAGGCCACTTCCT
CGGTGGAATCTCTGGCCTACAATATCGATTTCAAGACCAAAGTCACTCGGGCGGCATTTGAAGAAGCATGTAAAG
ATCTTCAACCCCGTTTCGTTCAGCCAATCTTCGACGCGCTCCTTTCTGCTGGGCTCAGTATGAATGACATTTCGT
CTGTGGTCTTCACTGGTGGAGCCACGAGAACGCCTATGGTTCAAGCCGCCGTCAAAAAAGTTGTTGGCGAGGATA
AAATGGCTTTCAACGTGAACGCGGATGAATCGATAGTGTTGGGTGCGGCCCTATATGGTGCTTCGCTCAGCCGGC
AGTTCAAGACCAAGAACATTAAGGTCAACGATCTCACCGTGTATGACCTTCAGGCATCGTATGCTGCTGCTCCAA
CTTCACCTGACGCGAAACCGAGAACTATAACGACTCTCGTATTCCCCGCTGGATCCAAAACCGGTACCAAGAAGA
CATTGACCTTTAAGAGGAAGGAAGATTTTACCATTAATCTCGATTATCGTGACCTTGGTGACTCGTCAGTGACCC
ATTCTACCTTGTTGTGTCACTTTTTGCTAACAGTTGTAAAGGGGTTTCCCTTCTCGTATGCTGGAGGCCGATATT
GTTGGCGTTGCTGAGGCTATCGCGAACCTCACTGAGCGCGGAGCAATCGATCCTGTCGTCAAAGCAACTCTTACA
CTCTCCGAATCTGGCTTTTTCAGTGTTTCCGATGCTGTCGCCTTTGGCGAAATCAAGGATGATAGTATCACTGGT
GAGTACACGTGGTGCATATTAGGAGTTGGAATAACGACTGATGTGAATTTTTCAGGAAAGTTAAAGGGACTCTTC
GCTGGAAGCAGCTCAGCAGACGAAACGTCTACTGGATCTGCGGAAAATACGCCACCTAGGGAGACTCCTGAAACC
GCGGAAACTGTTTCTCCATCCTCGTCATCATCAGCGTCGTCATCAGCTGATACTCCCGAGCCTACTACCAAGGTG
GAGGAAGAAAAGAAGAAGGCTCCTGTCGAAAATACAATCCCCCTCACTGTCAATGTCAGGTTTACGACAATATCT
CCAATGACCGTCGAGGAGAAACAACAGTCCAGGAAAAAGTTAGTATTTTGACTTCCTTCGGTTTGTCGTACTCAT
TTCTTTCTTTTAAGGCTTCGTGCTGTTGACCAAGAAGAAGCTATCAAGACTCGCCGCGAAGAAGCTCGTAATACT
TTCGAGAGCTACCTTTACCGTCTTCGCGATCTTTTGGATGACGAAAGTGCCGAGACGCCGTTCAAGAAATGTTCA
AGAGAAACCGAACGCGAGGCCCTCGCTACCCGGCTGGATGAATCCTTCCAATGGCTCTTCGACCGTGGTGATATA
GCCGACACGACTCATTTCCTCGATAAACGTATAGCACTCGAGTAGGCCTCCTTTCATATTCATGAGTTCATTATG
TTGATTGACTCTATTTCAGAACGCTCGAGAAACCAATCATTCATCGTTACAAAGAAATCGAAGCCTTCCCAGAAG
CGTTAAACAACTCCCAAAAATGGAATTTCCATACCCGTATATTCTTAACCGAAGCTAGGCAAAATCTTACTCTCG
AATCTGAAGCCGGTTTACCCTCGAAATGGACTTCCGAAGAACTTGATGGTCTAGAGAAGACTTTGAAAGATCATG
AGAAGTGGTTGAATGAGTGGGTAGAAAAACAGCGCTCTGTGAAGAGTTTTGAGGATCCTGTTATTGAAACTATGG
AGATGAAAGCTAGAGCCAAAACTTTGGAAACGCAGTTGTTCAAGTTGGTGAAGAGGAAGGTGCCGAAGACGAAGA
AGCCAGTGAAGAAGGATGAACCGGAGGCGAGTGGTACCAGTAGTGTGAAAGAGGATGCGAAATCCACTACTACTA
CGACGCCTACATCGACAACGACACCAGATATGAAGGAGGAGGAGAAGAATGGTGATGATTCGAGGACGCGTGATG
AACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail