Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|033880
Gene name
Locationscaffold_13:90807..94064
Strand+
Gene length (bp)3257
Transcript length (bp)2598
Coding sequence length (bp)2598
Protein length (aa) 866

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13513 HEAT_EZ HEAT-like repeat 1.1E-10 380 435
PF02985 HEAT HEAT repeat 1.6E-03 410 437
PF03810 IBN_N Importin-beta N-terminal domain 3.0E-08 28 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 1 865 0.0E+00
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 1 865 0.0E+00
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 1 865 0.0E+00
sp|O18388|IMB_DROME Importin subunit beta OS=Drosophila melanogaster GN=Fs(2)Ket PE=2 SV=2 1 865 0.0E+00
sp|P52296|IMB1_RAT Importin subunit beta-1 OS=Rattus norvegicus GN=Kpnb1 PE=1 SV=1 1 865 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 1 865 0.0E+00
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 1 865 0.0E+00
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 1 865 0.0E+00
sp|O18388|IMB_DROME Importin subunit beta OS=Drosophila melanogaster GN=Fs(2)Ket PE=2 SV=2 1 865 0.0E+00
sp|P52296|IMB1_RAT Importin subunit beta-1 OS=Rattus norvegicus GN=Kpnb1 PE=1 SV=1 1 865 0.0E+00
sp|Q06142|IMB1_YEAST Importin subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP95 PE=1 SV=1 6 861 0.0E+00
sp|Q9FJD4|IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana GN=KPNB1 PE=1 SV=1 1 821 0.0E+00
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 1 861 0.0E+00
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 12 733 1.0E-17
sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1 SV=2 12 733 3.0E-17
sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=1 SV=2 12 733 3.0E-17
sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 33 440 1.0E-15
sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 263 451 4.0E-14
sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=1 SV=3 12 736 9.0E-14
sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 263 451 1.0E-13
sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=1 SV=1 12 736 2.0E-13
sp|Q55CQ7|TNPO_DICDI Transportin OS=Dictyostelium discoideum GN=tnpo PE=3 SV=1 338 728 9.0E-12
sp|P38217|IMB2_YEAST Importin subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP104 PE=1 SV=1 341 465 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0005515 protein binding Yes
GO:0015031 protein transport No
GO:0051179 localization No
GO:0071705 nitrogen compound transport No
GO:0051234 establishment of localization No
GO:0005488 binding No
GO:0070727 cellular macromolecule localization No
GO:0051020 GTPase binding No
GO:0019899 enzyme binding No
GO:0008150 biological_process No
GO:0045184 establishment of protein localization No
GO:0051641 cellular localization No
GO:0006810 transport No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|033880
MNATDLLANTLSADARTREDATHKLDAASRENYPEYMIMLTSVLGSEGAPVHVRNAAGLALKNALSARDATRQQE
YSNRWLQLPVDTKNKIKQQTLETLASPLQKAGNFASQVVAAIAAVELPNNQWADLIELLLSFVNNQQNTNLKIAT
LQTIGFICEVIKPEILSLRSNEILTAVIHGARKEEPSSDVQLAAVHALYNSLEFVRENFEREGERNYIMQVVCEA
TQNQSVQVQVGAFECLVRIMGLYYDKMALYMEQALFGLTVMGMKHNDERVALQAVEFWSTVCEEEVELTVEAQEA
LDYGEQPEAESRQFAKVALPEIVPVLLQLLTKQDEDADDDEWNVSMAAATCLNLLAMAVQDAIVPAVIPFIEANI
KGDDWHLREAAIMTFGSILDGPDPGVLTPLVNQALPLLISMMNDQNLHVKDTTAWTLGRISDLLVTTIKTDVHLH
PLVSALVSGLTDSPRIATNCSWALKNLAEQLGGSFYDEDGNESPSGPLSPYYEGVIAALLRVTESGSNEANYRTA
AYQAIAAYLGQATADVIPAVLNTIDTVLTRMEHLLVIHEQIVGIDDRNNWNDLISNLCNVVMSVIRKLEANIQPR
ADRIMTINIGLLAAASKTTTIVEDTFLVIGALASALDTAFSPYIDHILTYLYPALKAHEDTQLCTTAVGLVGDIS
RALSEQSGKYAGHFMTVLLENLQSEVLNRNVKVSILSCFGDIALAVGPGFEPYFETTMTVLRQAGQVEPNPLDYD
LVDYVATLREGILEAYTGITTGFKKTDKAHLLLQHVPSILDLIQRCLKDDDRTDATMRLSYGLIGDLADSFPRGE
IKHLLLGQWIVGELRTKYKMPGETKKTLRWAREMVKVATQ*
Coding >AgabiH97|033880
ATGAACGCAACCGACCTCCTCGCCAACACTCTCTCTGCAGATGCCAGAACGCGCGAGGATGCCACCCACAAACTC
GACGCCGCCTCCCGCGAAAACTACCCCGAATACATGATCATGCTCACCTCCGTCCTCGGCAGCGAAGGCGCCCCC
GTCCACGTCAGAAACGCCGCCGGCCTCGCCCTCAAGAATGCCCTCTCCGCTCGCGACGCGACAAGGCAGCAGGAA
TACTCCAATCGCTGGCTTCAGCTTCCCGTAGACACAAAGAACAAGATCAAACAACAGACCCTCGAAACCCTCGCA
TCGCCCCTCCAAAAAGCCGGCAACTTTGCCTCCCAGGTCGTCGCCGCAATCGCCGCCGTCGAACTCCCCAACAAT
CAATGGGCTGATCTTATAGAGCTTCTCCTCAGCTTTGTCAACAACCAGCAAAACACAAATCTCAAAATCGCTACA
CTCCAGACCATCGGTTTCATCTGCGAAGTCATCAAACCCGAGATCCTCAGTCTCCGGTCCAATGAAATCCTCACC
GCCGTCATTCACGGCGCAAGGAAAGAGGAGCCTTCCTCCGATGTCCAACTCGCCGCAGTCCACGCCCTTTACAAC
TCCCTCGAGTTTGTTCGTGAGAATTTCGAGCGCGAGGGTGAACGAAATTACATCATGCAGGTCGTTTGCGAAGCA
ACCCAGAACCAATCAGTTCAGGTTCAAGTCGGCGCATTTGAATGCCTCGTTCGGATCATGGGCCTCTACTATGAC
AAAATGGCTCTCTACATGGAGCAGGCGCTTTTTGGCCTCACCGTCATGGGAATGAAACATAATGACGAGCGCGTG
GCTTTACAGGCAGTCGAGTTTTGGTCGACAGTCTGCGAGGAAGAGGTCGAACTCACTGTAGAAGCACAAGAGGCG
CTGGATTACGGCGAGCAACCCGAAGCCGAGTCAAGGCAATTCGCAAAGGTCGCTTTGCCCGAGATCGTCCCCGTC
CTTCTCCAACTCCTCACCAAACAAGACGAAGACGCCGACGATGATGAATGGAACGTATCCATGGCTGCAGCAACA
TGCCTCAACCTCCTCGCCATGGCAGTCCAGGACGCCATCGTACCCGCCGTCATTCCTTTCATCGAGGCCAACATC
AAAGGAGACGACTGGCATCTCCGCGAGGCAGCAATCATGACCTTTGGTTCCATTTTAGATGGGCCCGATCCCGGT
GTCCTTACTCCTCTCGTGAATCAAGCCCTACCCCTCTTGATCTCGATGATGAACGACCAAAATCTCCATGTCAAG
GACACGACCGCTTGGACACTAGGCAGGATTTCGGATCTGTTGGTGACAACCATCAAAACGGATGTTCACCTGCAT
CCATTGGTCTCTGCCCTCGTTAGTGGGCTGACAGATTCACCGAGGATCGCTACGAATTGCTCTTGGGCGCTGAAG
AATCTTGCAGAGCAGCTTGGGGGAAGCTTTTATGATGAGGATGGAAATGAGAGCCCGAGCGGACCCTTGTCTCCT
TACTATGAAGGTGTCATCGCTGCTTTGTTGCGTGTTACGGAGAGTGGGAGTAATGAGGCCAATTATCGTACGGCC
GCGTATCAGGCTATCGCTGCTTATCTTGGTCAAGCCACTGCTGATGTTATCCCTGCCGTTCTTAATACTATTGAT
ACCGTTCTTACTCGGATGGAGCATCTTTTGGTGATTCATGAACAAATTGTGGGTATCGATGATCGAAACAATTGG
AACGACCTTATCAGCAATTTATGCAATGTTGTCATGTCGGTGATTAGGAAACTGGAGGCCAATATTCAGCCTCGT
GCTGACCGGATTATGACTATTAATATTGGGTTACTTGCGGCTGCGAGTAAGACGACGACGATAGTTGAAGATACG
TTCCTTGTCATTGGAGCTCTCGCATCAGCCCTAGACACTGCATTCTCACCCTACATTGACCACATCCTCACCTAC
CTCTACCCCGCCCTCAAAGCACACGAAGACACACAATTATGCACTACCGCTGTCGGACTTGTCGGAGACATTTCT
CGTGCGTTGAGTGAACAAAGTGGGAAATATGCGGGACATTTTATGACTGTGTTGTTGGAGAATTTGCAGAGTGAG
GTGTTGAATAGGAATGTGAAGGTGTCTATTTTGTCGTGTTTTGGGGATATTGCGTTGGCGGTTGGGCCGGGGTTT
GAGCCGTATTTTGAGACGACGATGACGGTGTTGAGGCAGGCGGGACAGGTTGAACCTAATCCTTTGGATTATGAT
CTTGTGGATTATGTGGCGACTTTGAGAGAAGGTATACTTGAAGCTTATACTGGGATTACTACCGGGTTCAAGAAA
ACCGATAAAGCGCATCTGTTACTCCAACATGTGCCATCTATACTTGATTTGATTCAACGGTGTTTGAAAGACGAT
GATAGGACGGATGCGACGATGAGGTTGTCGTATGGGTTGATTGGGGATTTGGCGGATTCGTTTCCGAGGGGGGAG
ATTAAGCATTTGTTGTTGGGGCAGTGGATTGTGGGGGAGTTGAGGACGAAGTATAAGATGCCGGGGGAGACGAAG
AAGACGTTGAGGTGGGCGAGGGAGATGGTTAAGGTTGCGACGCAGTAG
Transcript >AgabiH97|033880
ATGAACGCAACCGACCTCCTCGCCAACACTCTCTCTGCAGATGCCAGAACGCGCGAGGATGCCACCCACAAACTC
GACGCCGCCTCCCGCGAAAACTACCCCGAATACATGATCATGCTCACCTCCGTCCTCGGCAGCGAAGGCGCCCCC
GTCCACGTCAGAAACGCCGCCGGCCTCGCCCTCAAGAATGCCCTCTCCGCTCGCGACGCGACAAGGCAGCAGGAA
TACTCCAATCGCTGGCTTCAGCTTCCCGTAGACACAAAGAACAAGATCAAACAACAGACCCTCGAAACCCTCGCA
TCGCCCCTCCAAAAAGCCGGCAACTTTGCCTCCCAGGTCGTCGCCGCAATCGCCGCCGTCGAACTCCCCAACAAT
CAATGGGCTGATCTTATAGAGCTTCTCCTCAGCTTTGTCAACAACCAGCAAAACACAAATCTCAAAATCGCTACA
CTCCAGACCATCGGTTTCATCTGCGAAGTCATCAAACCCGAGATCCTCAGTCTCCGGTCCAATGAAATCCTCACC
GCCGTCATTCACGGCGCAAGGAAAGAGGAGCCTTCCTCCGATGTCCAACTCGCCGCAGTCCACGCCCTTTACAAC
TCCCTCGAGTTTGTTCGTGAGAATTTCGAGCGCGAGGGTGAACGAAATTACATCATGCAGGTCGTTTGCGAAGCA
ACCCAGAACCAATCAGTTCAGGTTCAAGTCGGCGCATTTGAATGCCTCGTTCGGATCATGGGCCTCTACTATGAC
AAAATGGCTCTCTACATGGAGCAGGCGCTTTTTGGCCTCACCGTCATGGGAATGAAACATAATGACGAGCGCGTG
GCTTTACAGGCAGTCGAGTTTTGGTCGACAGTCTGCGAGGAAGAGGTCGAACTCACTGTAGAAGCACAAGAGGCG
CTGGATTACGGCGAGCAACCCGAAGCCGAGTCAAGGCAATTCGCAAAGGTCGCTTTGCCCGAGATCGTCCCCGTC
CTTCTCCAACTCCTCACCAAACAAGACGAAGACGCCGACGATGATGAATGGAACGTATCCATGGCTGCAGCAACA
TGCCTCAACCTCCTCGCCATGGCAGTCCAGGACGCCATCGTACCCGCCGTCATTCCTTTCATCGAGGCCAACATC
AAAGGAGACGACTGGCATCTCCGCGAGGCAGCAATCATGACCTTTGGTTCCATTTTAGATGGGCCCGATCCCGGT
GTCCTTACTCCTCTCGTGAATCAAGCCCTACCCCTCTTGATCTCGATGATGAACGACCAAAATCTCCATGTCAAG
GACACGACCGCTTGGACACTAGGCAGGATTTCGGATCTGTTGGTGACAACCATCAAAACGGATGTTCACCTGCAT
CCATTGGTCTCTGCCCTCGTTAGTGGGCTGACAGATTCACCGAGGATCGCTACGAATTGCTCTTGGGCGCTGAAG
AATCTTGCAGAGCAGCTTGGGGGAAGCTTTTATGATGAGGATGGAAATGAGAGCCCGAGCGGACCCTTGTCTCCT
TACTATGAAGGTGTCATCGCTGCTTTGTTGCGTGTTACGGAGAGTGGGAGTAATGAGGCCAATTATCGTACGGCC
GCGTATCAGGCTATCGCTGCTTATCTTGGTCAAGCCACTGCTGATGTTATCCCTGCCGTTCTTAATACTATTGAT
ACCGTTCTTACTCGGATGGAGCATCTTTTGGTGATTCATGAACAAATTGTGGGTATCGATGATCGAAACAATTGG
AACGACCTTATCAGCAATTTATGCAATGTTGTCATGTCGGTGATTAGGAAACTGGAGGCCAATATTCAGCCTCGT
GCTGACCGGATTATGACTATTAATATTGGGTTACTTGCGGCTGCGAGTAAGACGACGACGATAGTTGAAGATACG
TTCCTTGTCATTGGAGCTCTCGCATCAGCCCTAGACACTGCATTCTCACCCTACATTGACCACATCCTCACCTAC
CTCTACCCCGCCCTCAAAGCACACGAAGACACACAATTATGCACTACCGCTGTCGGACTTGTCGGAGACATTTCT
CGTGCGTTGAGTGAACAAAGTGGGAAATATGCGGGACATTTTATGACTGTGTTGTTGGAGAATTTGCAGAGTGAG
GTGTTGAATAGGAATGTGAAGGTGTCTATTTTGTCGTGTTTTGGGGATATTGCGTTGGCGGTTGGGCCGGGGTTT
GAGCCGTATTTTGAGACGACGATGACGGTGTTGAGGCAGGCGGGACAGGTTGAACCTAATCCTTTGGATTATGAT
CTTGTGGATTATGTGGCGACTTTGAGAGAAGGTATACTTGAAGCTTATACTGGGATTACTACCGGGTTCAAGAAA
ACCGATAAAGCGCATCTGTTACTCCAACATGTGCCATCTATACTTGATTTGATTCAACGGTGTTTGAAAGACGAT
GATAGGACGGATGCGACGATGAGGTTGTCGTATGGGTTGATTGGGGATTTGGCGGATTCGTTTCCGAGGGGGGAG
ATTAAGCATTTGTTGTTGGGGCAGTGGATTGTGGGGGAGTTGAGGACGAAGTATAAGATGCCGGGGGAGACGAAG
AAGACGTTGAGGTGGGCGAGGGAGATGGTTAAGGTTGCGACGCAGTAG
Gene >AgabiH97|033880
ATGAACGCAACCGACCTCCTCGCCAACACTCTCTCTGCAGGTAACTCGTCCGCTAATACATTTCACTCCGCGCTC
ACGTCTGCAGATGCCAGAACGCGCGAGGATGCCACCCACAAACTCGACGCCGCCTCCCGCGAAAACTACGTGCGC
TCCTTTTTTTCTTTTCTTTTTCTTTTGCACGCTCACCCACCCATGCCAGCCCGAATACATGATCATGCTCACCTC
CGTCCTCGGCAGCGAAGGCGCCCCCGTCCACGTCAGAAACGCCGCCGGCCTCGCCCTCAAGAATGCCCTCTCCGC
TCGCGTACGTCCTTCTCCCCCACTTCCCCCCTCTCACCCCCATCCACCCCTCATCGGGCCTCTCCTCTCTCCAGG
ACGCGACAAGGCAGCAGGAATACTCCAATCGCTGGCTTCAGCTTCCCGTAGACACAAAGAACAAGATCAAACAAC
AGACCCTCGAAACCCTCGCATCGCCCCTCCAAAAAGCCGGCAACTTTGCCTCCCAGGTCGTCGCCGCAATCGCCG
CCGTCGAACTCCCCAACAATCAATGGGCTGATCTTATAGAGCTTCTCCTCAGCTTTGTCAACAACCAGCAAAACA
CAAATCTCAAAATCGCTACACTCCAGACCATCGGTTTCATCTGCGAAGTCATCGTGCGTGTTCCCTGCCCTTCTC
TCTTCCCGCCCTCACGCGTTTCCTCTCCAGAAACCCGAGATCCTCAGTCTCCGGTCCAATGAAATCCTCACCGCC
GTCATTCACGGCGCAAGGAAAGAGGAGCCTTCCTCCGATGTCCAACTCGCCGCAGTCCACGCCCTTTACAACTCC
CTCGAGTTTGTTCGTGAGAATTTCGAGCGCGAGGTCCGTCTTCCTCGTTGCATCCCATTTTGATTCCATTACTCA
ACTCGTTGGCAGGGTGAACGAAATTACATCATGCAGGTCGTTTGCGAAGCAACCCAGAACCAATCAGTTCAGGTT
CAAGTCGGCGCATTTGAATGCCTCGTTCGGATCATGGGCCTCTACTATGACAAAATGGCTCTCTACATGGAGCAG
GCGCTTTTTGGCGTATGTTATTCCCCGCTTCACAAAGGCCCTTTGATGACCCTGATATCTTAGCTCACCGTCATG
GGAATGAAACATAATGACGAGCGCGTGGCTTTACAGGCAGTCGAGTTTTGGTCGACAGTCTGCGAGGAAGAGGTC
GAACTCACTGTAGAAGCACAAGAGGCGCTGGATTACGGCGAGCAACCCGAAGCCGAGTCAAGGCAATTCGCAAAG
GTCGCTTTGCCCGAGATCGTCCCCGTCCTTCTCCAACTCCTCACCAAACAAGACGAAGACGCCGACGATGATGAA
TGGAACGTATCCATGGCTGCAGCAACATGCCTCAACCTCCTCGCCATGGCAGTCCAGGACGCCATCGTACCCGCC
GTCATTCCTTTCATCGAGGCCAACATCAAAGGAGACGACTGGCATCTCCGCGAGGCAGCAATCATGACCTTTGGT
TCCATTTTAGATGGGCCCGATCCCGGTGTCCTTACTCCTCTCGTGAATCAAGCCCTACCCCTCTTGATCTCGATG
ATGAACGACCAAAATCTCCATGTCAAGGACACGACCGCTTGGACACTAGGCAGGATTTCGGATCTGTTGGTGACA
ACCATCAAAACGGATGTTCACCTGCATCCATTGGTCTCTGCCCTCGTTAGTGGGCTGACAGATTCACCGAGGATC
GCTACGAATTGCTCTTGGGCGCTGAAGAATCTTGCAGAGCAGCTTGGGGGAAGCTTTTATGATGAGGATGGAAAT
GAGAGCCCGAGCGGACCCTTGTCTCCTTACTATGAAGGTGTCATCGCTGCTTTGTTGCGTGTTACGGAGAGGTAC
GTTTTTCGGTGATAAAGTGTGGGTATATGCTGATTTTTGGGCTAGTGGGAGTAATGAGGCCAATTATCGTACGGC
CGCGTATCAGGCTATCGCTGCTTATCTTGGTCAAGCCACTGCTGATGTTATCCCTGCCGTTCTTAATACTATTGA
TACCGTTCTTACTCGGATGGAGCATCTTTTGGTGATTCATGTAAGGCGCTTTACTTTTTTTGATTGGCGATTTGA
CGGCTGATATGCGGATTGGATAGGAACAAATTGTGGGTATCGATGATCGAAACAATTGGAACGACCTTATCAGCA
ATTTATGCAATGTTGTCATGTCGGTGATTAGGAAACTGGAGGCCAATATTCAGCCTCGTGCTGACCGGATTATGA
CTATTAATATTGGGTTACTTGCGGCTGCGAGTAAGACGACGACGATAGTTGAAGATACGTTCCTTGTCATTGGAG
CTCTCGCATCAGGTAACGTTTTGAGCTATGCTGCGCTTACGTTTGCCTAACCTTGTCTCTCAGCCCTAGACACTG
CATTCTCACCCTACATTGACCACATCCTCACCTACCTCTACCCCGCCCTCAAAGCACACGAAGACACACAATTAT
GCACTACCGCTGTCGGACTTGTCGGAGACATTTCTCGTGCGTTGAGTGAACAAAGTGGGAAATATGCGGGACATT
TTATGACTGTGTTGTTGGAGAATTTGCAGAGTGAGGTGTTGAATAGGAATGTGAAGGTGTCTATTTTGTCGTGTT
TTGGGGATATTGCGTTGGCGGTTGGGCCGGGGTTTGAGCCGTATTTTGAGACGACGATGACGGTGTTGAGGCAGG
CGGGACAGGTTGAACCTAATCCTGTGAGTTTGATTGATTTTTTCTTTGTGATATGAATGTTGATGGGATTGGGTG
TAGTTGGATTATGATCTTGTGGATTATGTGGCGACTTTGAGAGAAGGTATACTTGAAGCTTATACTGGGATTACT
ACCGGGTTCAAGAAAACCGATAAAGGTGCGTTTTTAGTCTCGTCCATCCCACTTTTTATTCACATATTGATTTTT
TTTCTAGCGCATCTGTTACTCCAACATGTGCCATCTATACTTGATTTGATTCAACGGTGTTTGAAAGACGATGAT
AGGACGGATGCGACGATGAGGTTGTCGTATGGGTTGATTGGGGATTTGGCGGATTCGTTTCCGAGGGGGGAGATT
AAGCATTTGTTGTTGGGGCAGTGGATTGTGGGGGAGTTGAGGACGAAGTATAAGATGCCGGGGGAGACGAAGAAG
ACGTTGAGGTGGGCGAGGGAGGTGAGTGACTTTTTGTTTTTTTTTTGGAGATGGTGGTTGATGTGTGGTGGTTTT
TTTTTTAGATGGTTAAGGTTGCGACGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail