Protein ID | AgabiH97|033590 |
Gene name | |
Location | scaffold_13:5642..6074 |
Strand | + |
Gene length (bp) | 432 |
Transcript length (bp) | 432 |
Coding sequence length (bp) | 432 |
Protein length (aa) | 144 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 20 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 0.0 | 0.0 | 0.0 |
Initials | Initials knots | 0.0 | 0.0 | 0.0 |
Pileal_Stipeal_center | Stage I stipe center | 0.0 | 0.0 | 0.0 |
Pileal_Stipeal_shell | Stage I stipe shell | 0.0 | 0.0 | 0.0 |
DIF_stipe_center | Stage II stipe center | 0.0 | 0.0 | 0.0 |
DIF_stipe_shell | Stage II stipe shell | 0.0 | 0.0 | 0.0 |
DIF_stipe_skin | Stage II stipe skin | 0.0 | 0.0 | 0.0 |
DIF_cap_skin | Stage II cap skin | 0.0 | 0.0 | 0.0 |
DIF_cap_tissue | Stage II cap tissue | 0.0 | 0.0 | 0.0 |
DIF_gill_tissue | Stage II gill tissue | 0.0 | 0.0 | 0.0 |
YFB_stipe_center | Young fruiting body stipe center | 0.0 | 0.0 | 0.0 |
YFB_stipe_shell | Young fruiting body stipe shell | 0.0 | 0.0 | 0.0 |
YFB_stipe_skin | Young fruiting body stipe skin | 0.0 | 0.0 | 0.0 |
YFB_cap_skin | Young fruiting body cap skin | 0.0 | 0.0 | 0.0 |
YFB_cap_tissue | Young fruiting body cap tissue | 0.0 | 0.0 | 0.0 |
YFB_gill_tissue | Young fruiting body gill tissue | 0.0 | 0.0 | 0.0 |
YFB_veil | Young fruiting body veil | 0.0 | 0.0 | 0.0 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 1.0 | no |
Casing | YFB_stipe_center | 1.0 | no |
Casing | YFB_stipe_shell | 1.0 | no |
Casing | YFB_stipe_skin | 1.0 | no |
Casing | YFB_cap_skin | 1.0 | no |
Casing | YFB_cap_tissue | 1.0 | no |
Casing | YFB_gill_tissue | 1.0 | no |
Casing | YFB_veil | 1.0 | no |
Casing | Initials | 1.0 | no |
Casing | Pileal_Stipeal_center | 1.0 | no |
Casing | Pileal_Stipeal_shell | 1.0 | no |
Casing | DIF_stipe_center | 1.0 | no |
Casing | DIF_stipe_shell | 1.0 | no |
Casing | DIF_stipe_skin | 1.0 | no |
Casing | DIF_cap_skin | 1.0 | no |
Casing | DIF_cap_tissue | 1.0 | no |
DIF_gill_tissue | YFB_stipe_center | 1.0 | no |
DIF_gill_tissue | YFB_stipe_shell | 1.0 | no |
DIF_gill_tissue | YFB_stipe_skin | 1.0 | no |
DIF_gill_tissue | YFB_cap_skin | 1.0 | no |
DIF_gill_tissue | YFB_cap_tissue | 1.0 | no |
DIF_gill_tissue | YFB_gill_tissue | 1.0 | no |
DIF_gill_tissue | YFB_veil | 1.0 | no |
YFB_stipe_center | YFB_stipe_shell | 1.0 | no |
YFB_stipe_center | YFB_stipe_skin | 1.0 | no |
YFB_stipe_center | YFB_cap_skin | 1.0 | no |
YFB_stipe_center | YFB_cap_tissue | 1.0 | no |
YFB_stipe_center | YFB_gill_tissue | 1.0 | no |
YFB_stipe_center | YFB_veil | 1.0 | no |
YFB_stipe_shell | YFB_stipe_skin | 1.0 | no |
YFB_stipe_shell | YFB_cap_skin | 1.0 | no |
YFB_stipe_shell | YFB_cap_tissue | 1.0 | no |
YFB_stipe_shell | YFB_gill_tissue | 1.0 | no |
YFB_stipe_shell | YFB_veil | 1.0 | no |
YFB_stipe_skin | YFB_cap_skin | 1.0 | no |
YFB_stipe_skin | YFB_cap_tissue | 1.0 | no |
YFB_stipe_skin | YFB_gill_tissue | 1.0 | no |
YFB_stipe_skin | YFB_veil | 1.0 | no |
YFB_cap_skin | YFB_cap_tissue | 1.0 | no |
YFB_cap_skin | YFB_gill_tissue | 1.0 | no |
YFB_cap_skin | YFB_veil | 1.0 | no |
YFB_cap_tissue | YFB_gill_tissue | 1.0 | no |
YFB_cap_tissue | YFB_veil | 1.0 | no |
YFB_gill_tissue | YFB_veil | 1.0 | no |
Initials | DIF_gill_tissue | 1.0 | no |
Initials | YFB_stipe_center | 1.0 | no |
Initials | YFB_stipe_shell | 1.0 | no |
Initials | YFB_stipe_skin | 1.0 | no |
Initials | YFB_cap_skin | 1.0 | no |
Initials | YFB_cap_tissue | 1.0 | no |
Initials | YFB_gill_tissue | 1.0 | no |
Initials | YFB_veil | 1.0 | no |
Initials | Pileal_Stipeal_center | 1.0 | no |
Initials | Pileal_Stipeal_shell | 1.0 | no |
Initials | DIF_stipe_center | 1.0 | no |
Initials | DIF_stipe_shell | 1.0 | no |
Initials | DIF_stipe_skin | 1.0 | no |
Initials | DIF_cap_skin | 1.0 | no |
Initials | DIF_cap_tissue | 1.0 | no |
Pileal_Stipeal_center | DIF_gill_tissue | 1.0 | no |
Pileal_Stipeal_center | YFB_stipe_center | 1.0 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 1.0 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 1.0 | no |
Pileal_Stipeal_center | YFB_cap_skin | 1.0 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 1.0 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 1.0 | no |
Pileal_Stipeal_center | YFB_veil | 1.0 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 1.0 | no |
Pileal_Stipeal_center | DIF_stipe_center | 1.0 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 1.0 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 1.0 | no |
Pileal_Stipeal_center | DIF_cap_skin | 1.0 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 1.0 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 1.0 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 1.0 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 1.0 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 1.0 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 1.0 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 1.0 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 1.0 | no |
Pileal_Stipeal_shell | YFB_veil | 1.0 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 1.0 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 1.0 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 1.0 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 1.0 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 1.0 | no |
DIF_stipe_center | DIF_gill_tissue | 1.0 | no |
DIF_stipe_center | YFB_stipe_center | 1.0 | no |
DIF_stipe_center | YFB_stipe_shell | 1.0 | no |
DIF_stipe_center | YFB_stipe_skin | 1.0 | no |
DIF_stipe_center | YFB_cap_skin | 1.0 | no |
DIF_stipe_center | YFB_cap_tissue | 1.0 | no |
DIF_stipe_center | YFB_gill_tissue | 1.0 | no |
DIF_stipe_center | YFB_veil | 1.0 | no |
DIF_stipe_center | DIF_stipe_shell | 1.0 | no |
DIF_stipe_center | DIF_stipe_skin | 1.0 | no |
DIF_stipe_center | DIF_cap_skin | 1.0 | no |
DIF_stipe_center | DIF_cap_tissue | 1.0 | no |
DIF_stipe_shell | DIF_gill_tissue | 1.0 | no |
DIF_stipe_shell | YFB_stipe_center | 1.0 | no |
DIF_stipe_shell | YFB_stipe_shell | 1.0 | no |
DIF_stipe_shell | YFB_stipe_skin | 1.0 | no |
DIF_stipe_shell | YFB_cap_skin | 1.0 | no |
DIF_stipe_shell | YFB_cap_tissue | 1.0 | no |
DIF_stipe_shell | YFB_gill_tissue | 1.0 | no |
DIF_stipe_shell | YFB_veil | 1.0 | no |
DIF_stipe_shell | DIF_stipe_skin | 1.0 | no |
DIF_stipe_shell | DIF_cap_skin | 1.0 | no |
DIF_stipe_shell | DIF_cap_tissue | 1.0 | no |
DIF_stipe_skin | DIF_gill_tissue | 1.0 | no |
DIF_stipe_skin | YFB_stipe_center | 1.0 | no |
DIF_stipe_skin | YFB_stipe_shell | 1.0 | no |
DIF_stipe_skin | YFB_stipe_skin | 1.0 | no |
DIF_stipe_skin | YFB_cap_skin | 1.0 | no |
DIF_stipe_skin | YFB_cap_tissue | 1.0 | no |
DIF_stipe_skin | YFB_gill_tissue | 1.0 | no |
DIF_stipe_skin | YFB_veil | 1.0 | no |
DIF_stipe_skin | DIF_cap_skin | 1.0 | no |
DIF_stipe_skin | DIF_cap_tissue | 1.0 | no |
DIF_cap_skin | DIF_gill_tissue | 1.0 | no |
DIF_cap_skin | YFB_stipe_center | 1.0 | no |
DIF_cap_skin | YFB_stipe_shell | 1.0 | no |
DIF_cap_skin | YFB_stipe_skin | 1.0 | no |
DIF_cap_skin | YFB_cap_skin | 1.0 | no |
DIF_cap_skin | YFB_cap_tissue | 1.0 | no |
DIF_cap_skin | YFB_gill_tissue | 1.0 | no |
DIF_cap_skin | YFB_veil | 1.0 | no |
DIF_cap_skin | DIF_cap_tissue | 1.0 | no |
DIF_cap_tissue | DIF_gill_tissue | 1.0 | no |
DIF_cap_tissue | YFB_stipe_center | 1.0 | no |
DIF_cap_tissue | YFB_stipe_shell | 1.0 | no |
DIF_cap_tissue | YFB_stipe_skin | 1.0 | no |
DIF_cap_tissue | YFB_cap_skin | 1.0 | no |
DIF_cap_tissue | YFB_cap_tissue | 1.0 | no |
DIF_cap_tissue | YFB_gill_tissue | 1.0 | no |
DIF_cap_tissue | YFB_veil | 1.0 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|033590 MRPKMSLLLALSSLDYSPAFLAEVHSDYLDKGLSGHFLRLDKLGLLDRRFIVSKKRTKQLIDLTAMWRRTVLERR DHQATEVPAPTLSRGTAAPSTQTELRTSIVAKVAAAPQPVRRRPPVRTGPLDAWLIHRDAPPGEDNDV* |
Coding | >AgabiH97|033590 ATGCGCCCGAAGATGTCTCTACTCCTGGCGTTGAGTAGTCTGGATTATTCCCCGGCCTTTTTGGCTGAGGTACAT TCGGATTATCTTGACAAAGGGTTGTCAGGGCATTTTCTGCGGCTCGACAAACTCGGCCTTCTAGATCGCCGCTTT ATTGTGTCTAAAAAACGCACGAAGCAATTGATCGACCTTACCGCCATGTGGCGTCGGACCGTTCTGGAGCGCCGT GATCACCAAGCAACAGAAGTGCCTGCTCCGACACTTAGTCGTGGTACGGCGGCGCCTTCAACGCAGACGGAGCTT CGTACTTCGATTGTCGCGAAGGTTGCTGCTGCGCCGCAACCAGTTAGGAGACGGCCGCCTGTACGTACAGGTCCG CTTGACGCGTGGTTAATTCATCGGGATGCGCCTCCGGGTGAGGACAACGACGTTTGA |
Transcript | >AgabiH97|033590 ATGCGCCCGAAGATGTCTCTACTCCTGGCGTTGAGTAGTCTGGATTATTCCCCGGCCTTTTTGGCTGAGGTACAT TCGGATTATCTTGACAAAGGGTTGTCAGGGCATTTTCTGCGGCTCGACAAACTCGGCCTTCTAGATCGCCGCTTT ATTGTGTCTAAAAAACGCACGAAGCAATTGATCGACCTTACCGCCATGTGGCGTCGGACCGTTCTGGAGCGCCGT GATCACCAAGCAACAGAAGTGCCTGCTCCGACACTTAGTCGTGGTACGGCGGCGCCTTCAACGCAGACGGAGCTT CGTACTTCGATTGTCGCGAAGGTTGCTGCTGCGCCGCAACCAGTTAGGAGACGGCCGCCTGTACGTACAGGTCCG CTTGACGCGTGGTTAATTCATCGGGATGCGCCTCCGGGTGAGGACAACGACGTTTGA |
Gene | >AgabiH97|033590 ATGCGCCCGAAGATGTCTCTACTCCTGGCGTTGAGTAGTCTGGATTATTCCCCGGCCTTTTTGGCTGAGGTACAT TCGGATTATCTTGACAAAGGGTTGTCAGGGCATTTTCTGCGGCTCGACAAACTCGGCCTTCTAGATCGCCGCTTT ATTGTGTCTAAAAAACGCACGAAGCAATTGATCGACCTTACCGCCATGTGGCGTCGGACCGTTCTGGAGCGCCGT GATCACCAAGCAACAGAAGTGCCTGCTCCGACACTTAGTCGTGGTACGGCGGCGCCTTCAACGCAGACGGAGCTT CGTACTTCGATTGTCGCGAAGGTTGCTGCTGCGCCGCAACCAGTTAGGAGACGGCCGCCTGTACGTACAGGTCCG CTTGACGCGTGGTTAATTCATCGGGATGCGCCTCCGGGTGAGGACAACGACGTTTGA |