Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|033400
Gene name
Locationscaffold_12:1431367..1438589
Strand+
Gene length (bp)7222
Transcript length (bp)6537
Coding sequence length (bp)6537
Protein length (aa) 2179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 2.2E-136 1719 2118
PF00169 PH PH domain 3.4E-11 1287 1382
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.6E-09 1069 1140
PF13637 Ank_4 Ankyrin repeats (many copies) 4.1E-06 1079 1132
PF00023 Ank Ankyrin repeat 7.1E-04 1112 1138
PF15409 PH_8 Pleckstrin homology domain 4.9E-07 1294 1380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1696 2114 2.0E-105
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1698 2132 6.0E-102
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1490 2101 3.0E-96
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 1288 2111 2.0E-76
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 1288 2111 7.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1696 2114 2.0E-105
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1698 2132 6.0E-102
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1490 2101 3.0E-96
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 1288 2111 2.0E-76
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 1288 2111 7.0E-75
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 1719 2111 2.0E-68
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 1705 2109 3.0E-68
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 1705 2109 4.0E-66
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 1625 2117 8.0E-66
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 1719 2124 3.0E-65
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 1719 2109 3.0E-65
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 1686 2108 8.0E-65
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 1719 2101 1.0E-64
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 1694 2109 4.0E-64
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 1718 2124 1.0E-63
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 1625 2111 1.0E-62
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 1719 2124 6.0E-62
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 1700 2115 4.0E-61
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 1700 2115 3.0E-60
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 1719 2124 5.0E-60
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 1719 2124 6.0E-60
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 1715 2115 2.0E-59
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 1715 2115 9.0E-59
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 1715 2115 2.0E-58
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 1724 2088 2.0E-49
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 1719 2112 8.0E-46
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 1697 2103 8.0E-46
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 1712 2102 7.0E-43
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 1716 2118 2.0E-42
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 1720 2102 3.0E-42
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1038 1587 5.0E-42
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1080 1386 2.0E-36
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 1717 2102 2.0E-30
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1080 1386 3.0E-30
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 1729 1975 5.0E-21
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 1729 1975 2.0E-17
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 1720 1980 4.0E-17
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 1720 1974 7.0E-17
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 1696 1982 7.0E-17
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 1720 1974 2.0E-15
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 1731 1980 1.0E-14
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 1711 1980 1.0E-14
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 1713 1972 3.0E-14
sp|Q9HB20|PKHA3_HUMAN Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens GN=PLEKHA3 PE=1 SV=2 1287 1411 3.0E-12
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 1044 1351 6.0E-12
sp|Q9ERS4|PKHA3_MOUSE Pleckstrin homology domain-containing family A member 3 OS=Mus musculus GN=Plekha3 PE=2 SV=1 1287 1411 1.0E-11
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 1044 1339 3.0E-11
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 1721 1828 4.0E-11
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 1044 1552 9.0E-11
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 1286 1457 1.0E-10
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 1729 1980 5.0E-10
sp|Q5M7Y0|C43BP_DANRE Collagen type IV alpha-3-binding protein OS=Danio rerio GN=col4a3bp PE=1 SV=2 1287 1375 2.0E-09
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 1286 1378 3.0E-09
sp|Q96JA3|PKHA8_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens GN=PLEKHA8 PE=1 SV=3 1287 1403 4.0E-09
sp|Q80W71|PKHA8_MOUSE Pleckstrin homology domain-containing family A member 8 OS=Mus musculus GN=Plekha8 PE=1 SV=2 1287 1403 4.0E-09
sp|D3ZY60|PKHA8_RAT Pleckstrin homology domain-containing family A member 8 OS=Rattus norvegicus GN=Plekha8 PE=1 SV=1 1287 1403 4.0E-09
sp|Q6P3Q6|C43BP_XENTR Collagen type IV alpha-3-binding protein OS=Xenopus tropicalis GN=col4a3bp PE=2 SV=1 1280 1380 4.0E-09
sp|D2KC46|PKHA8_CANLF Pleckstrin homology domain-containing family A member 8 OS=Canis lupus familiaris GN=PLEKHA8 PE=1 SV=2 1287 1403 6.0E-09
sp|F1MS15|PKHA8_BOVIN Pleckstrin homology domain-containing family A member 8 OS=Bos taurus GN=PLEKHA8 PE=3 SV=2 1287 1403 6.0E-09
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 655 937 1.0E-08
sp|Q5U3N0|PKHA8_DANRE Pleckstrin homology domain-containing family A member 8 OS=Danio rerio GN=plekha8 PE=2 SV=1 1287 1403 1.0E-08
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 1722 1987 2.0E-08
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 1284 1378 2.0E-08
sp|Q9Y5P4|C43BP_HUMAN Collagen type IV alpha-3-binding protein OS=Homo sapiens GN=COL4A3BP PE=1 SV=1 1280 1380 2.0E-08
sp|Q9GKI7|C43BP_BOVIN Collagen type IV alpha-3-binding protein OS=Bos taurus GN=COL4A3BP PE=2 SV=1 1280 1380 2.0E-08
sp|Q6NRZ4|C43BP_XENLA Collagen type IV alpha-3-binding protein OS=Xenopus laevis GN=col4a3bp PE=2 SV=1 1284 1380 2.0E-08
sp|Q6VVX2|C43BP_CRIGR Collagen type IV alpha-3-binding protein OS=Cricetulus griseus GN=COL4A3BP PE=1 SV=1 1280 1380 2.0E-08
sp|Q5R6M6|C43BP_PONAB Collagen type IV alpha-3-binding protein OS=Pongo abelii GN=COL4A3BP PE=2 SV=1 1280 1380 2.0E-08
sp|Q9EQG9|C43BP_MOUSE Collagen type IV alpha-3-binding protein OS=Mus musculus GN=Col4a3bp PE=1 SV=1 1280 1380 3.0E-08
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 1728 2127 5.0E-08
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 1728 2127 9.0E-08
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 1728 2127 1.0E-07
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 652 865 2.0E-07
sp|P13934|LEA76_BRANA Late embryogenesis abundant protein 76 OS=Brassica napus PE=2 SV=2 725 920 2.0E-07
sp|Q8CIT9|SBSN_MOUSE Suprabasin OS=Mus musculus GN=Sbsn PE=2 SV=1 665 818 7.0E-07
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 1709 1852 7.0E-07
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 1285 1400 2.0E-06
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 1285 1378 2.0E-06
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 1287 1382 5.0E-06
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 1287 1382 8.0E-06
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 1734 1828 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008289 lipid binding Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|033400
MLNPRFSSLLLLSLYSTSILASNDWSKPCFNGICSYDLPDTPSGPSGTLKIWGSNTAIADITTAGGWEIIGCDPD
KEEQDIKIVCKGIDVDGDGDNDGCAHLFATTTTGGGNGSSSSMITSLPVPTGTVVQIGDDEDQRANGKIVRLPPE
CGKQAFGRIANTWTHTDQTLPPSISKRLNLPLHRRTKHHHKIKGLTIDTQFQKTDRSKFGDVKFAIVGANVPGAK
ASEDLNVNELGERKRNFVYSRVFRHRRGFGDFIDDVGGAISDGAAAVGGAISDGVGAVGEVISDGAGAVGGAISD
GAGAVGEVISDGAGAVGDAISDGAGAVGDVIDNVGGAISDGADAVGDAISDGAGAVGDAISDGAQAVGGAIANGA
EAVSDALSEPQEISKTFSAPFDISKTFTVFEQNIKCSAPITNTNTSFNPKIGVNGKLKVDVEADIHGNVDISIFA
SGSLTELKLDKFELSTSLNADLNGAIILSAGVGGSIESGNIKLFEVGIPGLDFPGIFSIGPTFQINANAKASLNI
DTDMRIGVAYHIDNAKFDFPNGGKKSGSFSAGDTPLQISAQPSSSATGTVEAHLIPSLNVGIDAFGGVAKAGVFV
NLDASASVSLTVDATGPVVEGKVNRREMMVRGGGAMGAYYFNDKRTPVPEPFGIGDIVDGIKDGAKKAAGAVKSG
AKKAAGAVESGAKKVVDGAKKAVDSGEKKVAGAVKEGAKNIEKGAKKVGGAVEDGAKKIGGAVKEGAEKVEEGAK
KVAKKVEEGAKKAGKVVKEGAEKVEEGAKKVVKEGAKKVEEGAKKAGKAVKEGAEKVEEGAKKVVKEGAKKVEEG
AKKAGKVVKEGAEKVEEGAKKTGKAVKEGAEKVEEGAKKIVKEGAEKVEEAGKVIKEGAEKVGEVAKEGAEKVEE
GVKKAGKVIDEGAKKIVNEEVEKEGAEKVEEGAKEDAKKVDNEGAKTGGATDDVSFGGCVEVGAGLSVNVGADAS
FFGLFDPFKKIPLFEKQFSLLKKCFGEQKRRDLSVVGRGLTCNGVNVRGVVELCGVLFCPAMEAVYQVKLLAALR
SGDPARIHPFLAEIGKDRSVSSLDCSAAALHLAVRCASTETVALLLAHRAISPNGVHPPASGTTPLHLAASLGRV
DIVTLLLDQDGIDDTLLDDQRKSCRDLAKTRDTLKAIDDSRTLLNASYRSLLRSYILSPFTDPPSPALLHLLSGP
RTSLINLSYLDDDSGSSLLHEAANRKDLRLIELAVRAGADVFVRNRRGKMAYEIVKDDKVKVFLRQFANHDHSFI
RSSFSASEPPALKGYLNKYTNVARGYHTRWFVLAHGVLSYYRHQQDESVSSRGSISMKSAIVKINEQHPNRFEIQ
SRLASASVQKWYIKANHPVEAARWILALNKSIEWARAAPEPPRSSAERSIAESDSIHAALSTDPNLSDLNPDDDE
EEGTRMPTDDASSMGMVSRHDDIYELQGNSILAQLEMTQRLLVSYFGGSTSSARSISSTTSTSHEIKSTILESMS
TLSTLAQEYTSMSKDREQCFQKALAQEKARQKVWEESLATVVREGATLEEELRNRSRKRGSKIFGPGEGFVAALS
GIGEEKESALGVTLVASPPAIDSPWKESPLAEPVRPRTSTNETVKPRQDGDSDEEDEEDEFFDAIDSNNLPNLVV
PPSLAVISPTTSPHPASPTKVKLPPTAQIQPPPLSPASIPSFIDMGPYKGYEVLRTKLGLMDDERPPTSLWSVLK
HSIGKDLTRISFPVFFNEPTSMLQRMAEDMEFSECLDTAATEMESLKRLAYVAAFAMSNYSSTIGRIAKPFNPML
SETFEYVRLDKKYRYVSEQVSHHPPISACWAESPLWHYFGEVDAQNKFMGKSFEIRPTGVAHAELILPESWVEED
KKGYRKAQGVCGGEGKVVEHYTWKKVTTNVSGFILGSPTIDHYGDMTVVNHATNEKCVLTFKPRGWRGKDAYEIA
GQVLDAKGRAVYEIAGRWNSQLIMRPVGSGGVLHPDTTVSSSSLDDLELNTTNNNTNNSPEYTLLWKNSPKPIGS
PFNLTPFAITLNECSKETLLPFLCPTDCRLRPDQRAFEMGKYDLANELKMRQEERQRGTRKEREMGVKGEHRPRW
FEARTDGDTGERVWMPKKVMVEFRVGSEEEGEDKEVRRRREEEVEYWAERERVWREGGFKRWKDVEEIFVEEPEV
LRE*
Coding >AgabiH97|033400
ATGTTAAATCCCCGATTCTCCTCTCTCCTCTTACTCTCCCTCTATTCAACATCCATCCTCGCCTCAAACGACTGG
TCCAAACCCTGTTTCAACGGTATCTGTTCCTACGATCTACCCGACACCCCCTCCGGTCCATCCGGCACACTCAAA
ATCTGGGGATCCAATACCGCCATAGCGGATATAACAACTGCAGGAGGATGGGAAATCATAGGTTGCGATCCAGAT
AAAGAAGAACAAGATATCAAAATCGTGTGTAAAGGTATAGATGTCGACGGTGACGGCGATAATGACGGTTGTGCG
CATTTATTCGCTACTACTACTACTGGTGGTGGTAATGGAAGCTCGTCGTCAATGATCACCAGTCTTCCTGTACCT
ACAGGAACAGTAGTTCAAATCGGAGACGACGAAGATCAACGAGCTAATGGCAAAATCGTTCGATTACCTCCCGAG
TGTGGTAAACAAGCTTTCGGACGTATAGCCAACACCTGGACACACACAGACCAAACTCTCCCTCCCTCCATCTCC
AAACGCCTTAACCTCCCCCTTCACCGCCGTACCAAACACCATCACAAAATCAAAGGCCTCACCATCGACACCCAA
TTCCAAAAAACCGACCGTTCTAAATTCGGTGACGTCAAATTCGCAATTGTAGGCGCTAATGTGCCAGGAGCGAAA
GCGTCGGAAGATTTGAATGTTAATGAACTTGGGGAGAGGAAGAGGAATTTTGTTTATTCGAGGGTGTTTAGACAT
AGGAGGGGATTTGGTGATTTTATTGATGATGTGGGGGGTGCTATAAGTGACGGCGCAGCAGCAGTGGGCGGTGCT
ATTAGTGATGGCGTGGGAGCAGTTGGCGAAGTTATAAGCGACGGTGCGGGAGCAGTTGGTGGCGCTATTAGCGAC
GGTGCTGGCGCAGTTGGCGAAGTTATCAGCGATGGTGCCGGCGCAGTGGGTGATGCTATAAGTGATGGCGCTGGT
GCAGTTGGTGATGTTATTGATAACGTGGGCGGGGCTATCAGTGACGGTGCTGACGCAGTAGGCGATGCTATCAGT
GATGGCGCAGGGGCAGTAGGCGATGCTATCAGCGACGGCGCACAAGCAGTCGGCGGTGCCATAGCCAATGGCGCC
GAAGCAGTCAGCGACGCCCTTTCCGAACCCCAAGAAATCAGCAAAACCTTTTCCGCCCCCTTCGACATCAGCAAA
ACCTTCACCGTCTTTGAACAAAACATCAAATGTTCAGCTCCAATCACCAACACAAACACCTCATTCAATCCCAAA
ATCGGAGTAAATGGAAAACTCAAGGTCGATGTAGAGGCGGATATACATGGAAATGTGGATATTAGTATTTTTGCG
AGTGGATCGTTGACGGAATTGAAATTGGATAAATTCGAGTTGAGCACTAGTTTGAATGCGGATTTGAATGGGGCG
ATTATCTTGTCAGCCGGGGTGGGTGGGTCCATCGAATCCGGAAATATCAAGCTTTTCGAAGTCGGTATACCCGGA
CTCGATTTTCCTGGGATATTCTCGATAGGACCAACGTTCCAAATCAACGCTAATGCCAAGGCGTCGTTGAACATT
GACACGGATATGCGGATTGGCGTTGCATATCATATTGATAATGCCAAGTTTGATTTCCCGAATGGAGGAAAGAAA
AGTGGATCGTTTAGTGCTGGTGACACACCACTTCAAATATCGGCGCAACCGTCATCTTCAGCAACAGGCACAGTT
GAAGCGCATCTGATTCCAAGTCTGAACGTGGGTATAGATGCGTTTGGAGGAGTGGCCAAGGCGGGGGTGTTTGTG
AATTTGGATGCGTCAGCAAGTGTGAGTTTGACGGTGGATGCGACGGGGCCGGTTGTAGAAGGGAAAGTGAATCGG
CGGGAAATGATGGTGCGGGGAGGGGGAGCTATGGGAGCGTATTATTTTAATGATAAGCGGACGCCTGTACCTGAG
CCATTTGGAATTGGGGATATTGTGGATGGGATCAAGGATGGAGCGAAGAAGGCTGCGGGGGCGGTGAAGAGTGGG
GCAAAGAAGGCTGCTGGTGCGGTCGAGAGCGGTGCAAAAAAGGTTGTTGACGGAGCGAAAAAAGCAGTTGATAGT
GGAGAGAAGAAAGTAGCTGGGGCGGTGAAAGAAGGAGCGAAAAATATTGAAAAAGGTGCAAAGAAAGTGGGAGGA
GCGGTTGAGGACGGGGCAAAGAAGATTGGCGGAGCGGTCAAGGAGGGAGCAGAAAAAGTGGAAGAGGGTGCCAAG
AAGGTCGCCAAAAAGGTTGAAGAGGGTGCCAAGAAGGCGGGTAAAGTTGTGAAAGAGGGAGCCGAAAAGGTAGAA
GAAGGCGCTAAGAAGGTTGTTAAAGAGGGCGCCAAAAAGGTCGAGGAAGGAGCCAAGAAAGCAGGCAAAGCTGTG
AAAGAGGGCGCCGAGAAGGTCGAGGAAGGTGCCAAGAAGGTAGTCAAAGAGGGCGCCAAAAAAGTGGAAGAGGGA
GCCAAGAAGGCAGGTAAAGTTGTTAAGGAGGGTGCAGAAAAAGTTGAAGAAGGTGCGAAGAAGACGGGTAAGGCT
GTGAAGGAGGGAGCCGAAAAGGTTGAGGAAGGCGCCAAGAAGATAGTCAAAGAGGGAGCAGAGAAAGTGGAAGAG
GCAGGTAAAGTTATTAAAGAAGGAGCAGAAAAGGTCGGGGAGGTAGCCAAAGAGGGCGCCGAGAAGGTTGAGGAG
GGCGTCAAGAAGGCAGGAAAAGTGATTGATGAAGGCGCCAAGAAGATAGTCAACGAGGAAGTCGAGAAAGAAGGA
GCAGAAAAAGTGGAGGAAGGTGCCAAGGAGGATGCCAAGAAGGTAGATAACGAGGGTGCCAAGACAGGGGGAGCA
ACGGATGACGTCAGCTTTGGGGGATGCGTCGAAGTGGGCGCGGGGTTGTCGGTGAACGTCGGAGCCGATGCAAGC
TTTTTCGGGCTATTCGATCCGTTCAAGAAGATTCCGCTGTTTGAGAAGCAGTTTTCGTTGCTCAAGAAATGTTTT
GGAGAACAGAAGCGACGGGACCTGAGTGTGGTGGGCCGGGGACTGACGTGTAATGGAGTGAATGTTCGCGGGGTA
GTCGAGTTGTGCGGTGTTTTGTTCTGTCCAGCCATGGAGGCGGTCTACCAAGTCAAGCTTCTCGCCGCCCTCAGA
TCAGGCGATCCAGCGCGGATCCACCCCTTTCTCGCTGAAATTGGCAAGGACCGGTCGGTGTCGTCTCTCGACTGT
TCAGCTGCTGCTCTCCACCTCGCCGTCCGATGTGCCTCCACGGAGACGGTCGCTCTTCTTCTCGCCCACCGCGCC
ATATCGCCCAACGGTGTTCACCCCCCCGCCTCGGGCACCACGCCCCTCCACCTTGCCGCCTCCCTTGGCAGAGTC
GACATCGTCACCCTCCTCCTTGACCAGGACGGCATCGACGACACCCTCCTCGACGACCAGCGCAAGTCCTGCCGC
GACCTCGCAAAAACCAGAGACACCCTCAAAGCCATCGATGACTCACGCACCCTCCTCAATGCCTCCTACCGCTCG
CTCCTCCGCTCCTACATCCTCTCCCCCTTCACCGACCCTCCCTCTCCTGCACTCCTCCACCTCCTCAGCGGACCC
CGCACCTCTCTCATCAACCTCTCCTATCTCGACGACGATTCTGGTTCGTCTCTCTTGCACGAAGCCGCCAACAGA
AAGGATCTCCGTCTCATCGAGCTCGCCGTCCGCGCCGGCGCAGATGTCTTTGTCCGCAACCGCAGGGGAAAGATG
GCTTATGAGATCGTCAAGGATGACAAGGTCAAGGTATTCCTACGTCAATTCGCCAATCACGATCACTCCTTCATT
CGATCCTCCTTTTCCGCTTCAGAACCACCCGCACTCAAGGGCTATCTCAACAAATACACCAACGTCGCCAGGGGC
TACCACACCCGCTGGTTTGTCCTCGCTCATGGTGTCCTCTCATACTACCGTCACCAGCAAGACGAGTCTGTATCG
TCTCGCGGTTCCATCTCCATGAAATCCGCCATCGTCAAAATCAACGAACAACACCCCAATAGATTCGAAATCCAG
TCCCGACTCGCTTCTGCCTCGGTCCAAAAATGGTACATTAAAGCAAATCACCCTGTCGAAGCCGCACGTTGGATT
CTCGCTCTCAACAAAAGCATAGAATGGGCTAGAGCCGCACCGGAACCTCCTAGATCCAGTGCTGAAAGGAGTATT
GCAGAGTCCGATTCCATCCATGCTGCCCTCAGTACGGATCCTAATTTGTCGGATTTGAATCCGGATGACGATGAG
GAAGAGGGGACGAGGATGCCGACGGATGATGCGTCTTCGATGGGGATGGTGTCTCGTCATGACGACATTTATGAA
CTTCAAGGAAACTCGATTTTGGCTCAGCTGGAGATGACACAGCGGTTGCTCGTGTCTTATTTTGGAGGGTCGACG
TCCTCTGCGCGGTCAATCAGTTCGACTACTTCGACGAGTCACGAAATCAAGTCTACTATCCTTGAATCCATGTCT
ACCCTGTCTACTCTTGCACAAGAATACACCTCCATGTCGAAAGACCGTGAACAGTGTTTTCAGAAGGCGCTCGCT
CAGGAAAAAGCGAGACAGAAGGTGTGGGAAGAGTCCTTGGCGACGGTCGTCAGAGAGGGGGCGACGTTGGAAGAA
GAGTTGAGGAATAGGAGTAGGAAGAGGGGGTCTAAAATTTTTGGACCTGGGGAAGGGTTTGTTGCCGCTTTGAGT
GGCATTGGGGAGGAGAAGGAAAGTGCTTTGGGAGTGACCTTGGTAGCTTCCCCTCCTGCCATTGACAGTCCGTGG
AAAGAGTCGCCGTTGGCGGAACCCGTTCGACCACGAACGTCGACGAATGAAACCGTGAAACCGCGTCAGGATGGG
GATTCGGATGAAGAAGACGAGGAAGATGAATTTTTCGATGCGATTGATTCGAACAATCTACCTAATCTCGTTGTC
CCTCCTTCCCTTGCCGTCATCTCCCCCACCACCTCTCCTCATCCAGCCTCCCCCACCAAAGTCAAACTACCGCCG
ACAGCACAGATTCAACCGCCACCCCTATCCCCTGCATCTATACCGTCGTTTATTGACATGGGACCCTACAAGGGG
TATGAGGTGTTGAGGACCAAATTGGGATTGATGGACGATGAGAGGCCGCCGACGAGTTTGTGGAGTGTGTTGAAA
CATTCGATTGGGAAGGATTTGACGAGGATTAGTTTTCCCGTCTTTTTTAATGAGCCGACGAGTATGTTGCAGAGG
ATGGCGGAGGATATGGAGTTTAGTGAGTGTTTGGATACGGCCGCGACGGAGATGGAGTCGTTGAAGAGGTTGGCT
TATGTTGCTGCTTTTGCGATGAGTAATTATTCGAGTACGATTGGGAGGATTGCGAAACCGTTTAATCCGATGTTG
AGCGAGACGTTTGAGTATGTGAGGTTGGACAAGAAATATCGATATGTGTCGGAACAAGTCAGTCATCATCCACCG
ATTTCGGCGTGTTGGGCAGAATCGCCTTTGTGGCATTATTTTGGAGAGGTGGATGCGCAAAACAAGTTTATGGGT
AAATCGTTTGAGATTAGACCTACGGGTGTGGCGCATGCTGAATTGATTTTACCGGAATCGTGGGTGGAGGAGGAT
AAGAAAGGGTATAGAAAGGCGCAAGGGGTGTGTGGGGGAGAGGGAAAGGTGGTGGAACATTATACGTGGAAGAAA
GTGACGACGAATGTGTCGGGGTTTATTTTGGGGAGTCCGACGATTGATCATTATGGAGATATGACTGTGGTGAAT
CATGCTACGAATGAGAAATGTGTATTGACGTTTAAACCACGTGGATGGAGGGGTAAAGATGCGTATGAGATTGCG
GGACAGGTGTTGGATGCGAAAGGGAGGGCTGTGTATGAGATTGCGGGGAGGTGGAATTCGCAGTTGATTATGAGG
CCTGTGGGGAGTGGGGGAGTGTTGCATCCTGATACGACAGTGTCGTCTTCGTCTTTGGATGATTTGGAACTCAAC
ACCACAAACAACAACACCAACAACAGTCCGGAATATACTCTGCTATGGAAAAACTCACCGAAACCGATTGGGTCT
CCGTTCAATTTGACACCGTTTGCGATTACGTTGAATGAATGTTCGAAAGAGACGCTTTTACCGTTTTTGTGTCCG
ACGGATTGTAGATTGAGACCGGATCAGAGGGCGTTTGAGATGGGGAAATATGATTTGGCGAATGAGTTGAAGATG
AGGCAGGAGGAGAGGCAGAGGGGGACGAGGAAGGAGAGGGAGATGGGGGTTAAGGGGGAACATAGGCCTAGGTGG
TTTGAGGCGAGGACGGATGGGGATACGGGGGAGAGGGTGTGGATGCCGAAGAAGGTGATGGTGGAGTTTAGGGTG
GGGAGTGAGGAAGAGGGGGAGGATAAGGAGGTGAGGAGGAGGAGGGAGGAGGAGGTTGAGTATTGGGCGGAGAGG
GAGAGGGTTTGGAGGGAGGGTGGGTTTAAGAGGTGGAAGGATGTGGAGGAGATATTTGTGGAGGAGCCGGAGGTT
TTGAGGGAATGA
Transcript >AgabiH97|033400
ATGTTAAATCCCCGATTCTCCTCTCTCCTCTTACTCTCCCTCTATTCAACATCCATCCTCGCCTCAAACGACTGG
TCCAAACCCTGTTTCAACGGTATCTGTTCCTACGATCTACCCGACACCCCCTCCGGTCCATCCGGCACACTCAAA
ATCTGGGGATCCAATACCGCCATAGCGGATATAACAACTGCAGGAGGATGGGAAATCATAGGTTGCGATCCAGAT
AAAGAAGAACAAGATATCAAAATCGTGTGTAAAGGTATAGATGTCGACGGTGACGGCGATAATGACGGTTGTGCG
CATTTATTCGCTACTACTACTACTGGTGGTGGTAATGGAAGCTCGTCGTCAATGATCACCAGTCTTCCTGTACCT
ACAGGAACAGTAGTTCAAATCGGAGACGACGAAGATCAACGAGCTAATGGCAAAATCGTTCGATTACCTCCCGAG
TGTGGTAAACAAGCTTTCGGACGTATAGCCAACACCTGGACACACACAGACCAAACTCTCCCTCCCTCCATCTCC
AAACGCCTTAACCTCCCCCTTCACCGCCGTACCAAACACCATCACAAAATCAAAGGCCTCACCATCGACACCCAA
TTCCAAAAAACCGACCGTTCTAAATTCGGTGACGTCAAATTCGCAATTGTAGGCGCTAATGTGCCAGGAGCGAAA
GCGTCGGAAGATTTGAATGTTAATGAACTTGGGGAGAGGAAGAGGAATTTTGTTTATTCGAGGGTGTTTAGACAT
AGGAGGGGATTTGGTGATTTTATTGATGATGTGGGGGGTGCTATAAGTGACGGCGCAGCAGCAGTGGGCGGTGCT
ATTAGTGATGGCGTGGGAGCAGTTGGCGAAGTTATAAGCGACGGTGCGGGAGCAGTTGGTGGCGCTATTAGCGAC
GGTGCTGGCGCAGTTGGCGAAGTTATCAGCGATGGTGCCGGCGCAGTGGGTGATGCTATAAGTGATGGCGCTGGT
GCAGTTGGTGATGTTATTGATAACGTGGGCGGGGCTATCAGTGACGGTGCTGACGCAGTAGGCGATGCTATCAGT
GATGGCGCAGGGGCAGTAGGCGATGCTATCAGCGACGGCGCACAAGCAGTCGGCGGTGCCATAGCCAATGGCGCC
GAAGCAGTCAGCGACGCCCTTTCCGAACCCCAAGAAATCAGCAAAACCTTTTCCGCCCCCTTCGACATCAGCAAA
ACCTTCACCGTCTTTGAACAAAACATCAAATGTTCAGCTCCAATCACCAACACAAACACCTCATTCAATCCCAAA
ATCGGAGTAAATGGAAAACTCAAGGTCGATGTAGAGGCGGATATACATGGAAATGTGGATATTAGTATTTTTGCG
AGTGGATCGTTGACGGAATTGAAATTGGATAAATTCGAGTTGAGCACTAGTTTGAATGCGGATTTGAATGGGGCG
ATTATCTTGTCAGCCGGGGTGGGTGGGTCCATCGAATCCGGAAATATCAAGCTTTTCGAAGTCGGTATACCCGGA
CTCGATTTTCCTGGGATATTCTCGATAGGACCAACGTTCCAAATCAACGCTAATGCCAAGGCGTCGTTGAACATT
GACACGGATATGCGGATTGGCGTTGCATATCATATTGATAATGCCAAGTTTGATTTCCCGAATGGAGGAAAGAAA
AGTGGATCGTTTAGTGCTGGTGACACACCACTTCAAATATCGGCGCAACCGTCATCTTCAGCAACAGGCACAGTT
GAAGCGCATCTGATTCCAAGTCTGAACGTGGGTATAGATGCGTTTGGAGGAGTGGCCAAGGCGGGGGTGTTTGTG
AATTTGGATGCGTCAGCAAGTGTGAGTTTGACGGTGGATGCGACGGGGCCGGTTGTAGAAGGGAAAGTGAATCGG
CGGGAAATGATGGTGCGGGGAGGGGGAGCTATGGGAGCGTATTATTTTAATGATAAGCGGACGCCTGTACCTGAG
CCATTTGGAATTGGGGATATTGTGGATGGGATCAAGGATGGAGCGAAGAAGGCTGCGGGGGCGGTGAAGAGTGGG
GCAAAGAAGGCTGCTGGTGCGGTCGAGAGCGGTGCAAAAAAGGTTGTTGACGGAGCGAAAAAAGCAGTTGATAGT
GGAGAGAAGAAAGTAGCTGGGGCGGTGAAAGAAGGAGCGAAAAATATTGAAAAAGGTGCAAAGAAAGTGGGAGGA
GCGGTTGAGGACGGGGCAAAGAAGATTGGCGGAGCGGTCAAGGAGGGAGCAGAAAAAGTGGAAGAGGGTGCCAAG
AAGGTCGCCAAAAAGGTTGAAGAGGGTGCCAAGAAGGCGGGTAAAGTTGTGAAAGAGGGAGCCGAAAAGGTAGAA
GAAGGCGCTAAGAAGGTTGTTAAAGAGGGCGCCAAAAAGGTCGAGGAAGGAGCCAAGAAAGCAGGCAAAGCTGTG
AAAGAGGGCGCCGAGAAGGTCGAGGAAGGTGCCAAGAAGGTAGTCAAAGAGGGCGCCAAAAAAGTGGAAGAGGGA
GCCAAGAAGGCAGGTAAAGTTGTTAAGGAGGGTGCAGAAAAAGTTGAAGAAGGTGCGAAGAAGACGGGTAAGGCT
GTGAAGGAGGGAGCCGAAAAGGTTGAGGAAGGCGCCAAGAAGATAGTCAAAGAGGGAGCAGAGAAAGTGGAAGAG
GCAGGTAAAGTTATTAAAGAAGGAGCAGAAAAGGTCGGGGAGGTAGCCAAAGAGGGCGCCGAGAAGGTTGAGGAG
GGCGTCAAGAAGGCAGGAAAAGTGATTGATGAAGGCGCCAAGAAGATAGTCAACGAGGAAGTCGAGAAAGAAGGA
GCAGAAAAAGTGGAGGAAGGTGCCAAGGAGGATGCCAAGAAGGTAGATAACGAGGGTGCCAAGACAGGGGGAGCA
ACGGATGACGTCAGCTTTGGGGGATGCGTCGAAGTGGGCGCGGGGTTGTCGGTGAACGTCGGAGCCGATGCAAGC
TTTTTCGGGCTATTCGATCCGTTCAAGAAGATTCCGCTGTTTGAGAAGCAGTTTTCGTTGCTCAAGAAATGTTTT
GGAGAACAGAAGCGACGGGACCTGAGTGTGGTGGGCCGGGGACTGACGTGTAATGGAGTGAATGTTCGCGGGGTA
GTCGAGTTGTGCGGTGTTTTGTTCTGTCCAGCCATGGAGGCGGTCTACCAAGTCAAGCTTCTCGCCGCCCTCAGA
TCAGGCGATCCAGCGCGGATCCACCCCTTTCTCGCTGAAATTGGCAAGGACCGGTCGGTGTCGTCTCTCGACTGT
TCAGCTGCTGCTCTCCACCTCGCCGTCCGATGTGCCTCCACGGAGACGGTCGCTCTTCTTCTCGCCCACCGCGCC
ATATCGCCCAACGGTGTTCACCCCCCCGCCTCGGGCACCACGCCCCTCCACCTTGCCGCCTCCCTTGGCAGAGTC
GACATCGTCACCCTCCTCCTTGACCAGGACGGCATCGACGACACCCTCCTCGACGACCAGCGCAAGTCCTGCCGC
GACCTCGCAAAAACCAGAGACACCCTCAAAGCCATCGATGACTCACGCACCCTCCTCAATGCCTCCTACCGCTCG
CTCCTCCGCTCCTACATCCTCTCCCCCTTCACCGACCCTCCCTCTCCTGCACTCCTCCACCTCCTCAGCGGACCC
CGCACCTCTCTCATCAACCTCTCCTATCTCGACGACGATTCTGGTTCGTCTCTCTTGCACGAAGCCGCCAACAGA
AAGGATCTCCGTCTCATCGAGCTCGCCGTCCGCGCCGGCGCAGATGTCTTTGTCCGCAACCGCAGGGGAAAGATG
GCTTATGAGATCGTCAAGGATGACAAGGTCAAGGTATTCCTACGTCAATTCGCCAATCACGATCACTCCTTCATT
CGATCCTCCTTTTCCGCTTCAGAACCACCCGCACTCAAGGGCTATCTCAACAAATACACCAACGTCGCCAGGGGC
TACCACACCCGCTGGTTTGTCCTCGCTCATGGTGTCCTCTCATACTACCGTCACCAGCAAGACGAGTCTGTATCG
TCTCGCGGTTCCATCTCCATGAAATCCGCCATCGTCAAAATCAACGAACAACACCCCAATAGATTCGAAATCCAG
TCCCGACTCGCTTCTGCCTCGGTCCAAAAATGGTACATTAAAGCAAATCACCCTGTCGAAGCCGCACGTTGGATT
CTCGCTCTCAACAAAAGCATAGAATGGGCTAGAGCCGCACCGGAACCTCCTAGATCCAGTGCTGAAAGGAGTATT
GCAGAGTCCGATTCCATCCATGCTGCCCTCAGTACGGATCCTAATTTGTCGGATTTGAATCCGGATGACGATGAG
GAAGAGGGGACGAGGATGCCGACGGATGATGCGTCTTCGATGGGGATGGTGTCTCGTCATGACGACATTTATGAA
CTTCAAGGAAACTCGATTTTGGCTCAGCTGGAGATGACACAGCGGTTGCTCGTGTCTTATTTTGGAGGGTCGACG
TCCTCTGCGCGGTCAATCAGTTCGACTACTTCGACGAGTCACGAAATCAAGTCTACTATCCTTGAATCCATGTCT
ACCCTGTCTACTCTTGCACAAGAATACACCTCCATGTCGAAAGACCGTGAACAGTGTTTTCAGAAGGCGCTCGCT
CAGGAAAAAGCGAGACAGAAGGTGTGGGAAGAGTCCTTGGCGACGGTCGTCAGAGAGGGGGCGACGTTGGAAGAA
GAGTTGAGGAATAGGAGTAGGAAGAGGGGGTCTAAAATTTTTGGACCTGGGGAAGGGTTTGTTGCCGCTTTGAGT
GGCATTGGGGAGGAGAAGGAAAGTGCTTTGGGAGTGACCTTGGTAGCTTCCCCTCCTGCCATTGACAGTCCGTGG
AAAGAGTCGCCGTTGGCGGAACCCGTTCGACCACGAACGTCGACGAATGAAACCGTGAAACCGCGTCAGGATGGG
GATTCGGATGAAGAAGACGAGGAAGATGAATTTTTCGATGCGATTGATTCGAACAATCTACCTAATCTCGTTGTC
CCTCCTTCCCTTGCCGTCATCTCCCCCACCACCTCTCCTCATCCAGCCTCCCCCACCAAAGTCAAACTACCGCCG
ACAGCACAGATTCAACCGCCACCCCTATCCCCTGCATCTATACCGTCGTTTATTGACATGGGACCCTACAAGGGG
TATGAGGTGTTGAGGACCAAATTGGGATTGATGGACGATGAGAGGCCGCCGACGAGTTTGTGGAGTGTGTTGAAA
CATTCGATTGGGAAGGATTTGACGAGGATTAGTTTTCCCGTCTTTTTTAATGAGCCGACGAGTATGTTGCAGAGG
ATGGCGGAGGATATGGAGTTTAGTGAGTGTTTGGATACGGCCGCGACGGAGATGGAGTCGTTGAAGAGGTTGGCT
TATGTTGCTGCTTTTGCGATGAGTAATTATTCGAGTACGATTGGGAGGATTGCGAAACCGTTTAATCCGATGTTG
AGCGAGACGTTTGAGTATGTGAGGTTGGACAAGAAATATCGATATGTGTCGGAACAAGTCAGTCATCATCCACCG
ATTTCGGCGTGTTGGGCAGAATCGCCTTTGTGGCATTATTTTGGAGAGGTGGATGCGCAAAACAAGTTTATGGGT
AAATCGTTTGAGATTAGACCTACGGGTGTGGCGCATGCTGAATTGATTTTACCGGAATCGTGGGTGGAGGAGGAT
AAGAAAGGGTATAGAAAGGCGCAAGGGGTGTGTGGGGGAGAGGGAAAGGTGGTGGAACATTATACGTGGAAGAAA
GTGACGACGAATGTGTCGGGGTTTATTTTGGGGAGTCCGACGATTGATCATTATGGAGATATGACTGTGGTGAAT
CATGCTACGAATGAGAAATGTGTATTGACGTTTAAACCACGTGGATGGAGGGGTAAAGATGCGTATGAGATTGCG
GGACAGGTGTTGGATGCGAAAGGGAGGGCTGTGTATGAGATTGCGGGGAGGTGGAATTCGCAGTTGATTATGAGG
CCTGTGGGGAGTGGGGGAGTGTTGCATCCTGATACGACAGTGTCGTCTTCGTCTTTGGATGATTTGGAACTCAAC
ACCACAAACAACAACACCAACAACAGTCCGGAATATACTCTGCTATGGAAAAACTCACCGAAACCGATTGGGTCT
CCGTTCAATTTGACACCGTTTGCGATTACGTTGAATGAATGTTCGAAAGAGACGCTTTTACCGTTTTTGTGTCCG
ACGGATTGTAGATTGAGACCGGATCAGAGGGCGTTTGAGATGGGGAAATATGATTTGGCGAATGAGTTGAAGATG
AGGCAGGAGGAGAGGCAGAGGGGGACGAGGAAGGAGAGGGAGATGGGGGTTAAGGGGGAACATAGGCCTAGGTGG
TTTGAGGCGAGGACGGATGGGGATACGGGGGAGAGGGTGTGGATGCCGAAGAAGGTGATGGTGGAGTTTAGGGTG
GGGAGTGAGGAAGAGGGGGAGGATAAGGAGGTGAGGAGGAGGAGGGAGGAGGAGGTTGAGTATTGGGCGGAGAGG
GAGAGGGTTTGGAGGGAGGGTGGGTTTAAGAGGTGGAAGGATGTGGAGGAGATATTTGTGGAGGAGCCGGAGGTT
TTGAGGGAATGA
Gene >AgabiH97|033400
ATGTTAAATCCCCGATTCTCCTCTCTCCTCTTACTCTCCCTCTATTCAACATCCATCCTCGCCTCAAACGACTGG
TCCAAACCCTGTTTCAACGGTATCTGTTCCTACGATCTACCCGACACCCCCTCCGGTCCATCCGGCACACTCAAA
ATCGTACGTTCATCTCCATGAGTATCACCATATATAAATAAAAATCCTAATTATTTATAGTGGGGATCCAATACC
GCCATAGCGGATATAACAACTGCAGGAGGATGGGAAATCATAGGTTGCGATCCAGATAAAGAAGAACAAGATATC
AAAATCGTGTGTAAAGGTATAGATGTCGACGGTGACGGCGATAATGACGGTTGTGCGCATTTATTCGCTACTACT
ACTACTGGTGGTGGTAATGGAAGCTCGTCGTCAATGATCACCAGTCTTCCTGTACCTACAGGAACAGTAGTTCAA
ATCGGAGACGACGAAGATCAACGAGCTAATGGCAAAATCGTTCGATTACCTCCCGAGGTAAGCATAATGCATCAA
TATATATATATTGACTAAAACTATTGTAATATACAGTGTGGTAAACAAGCTTTCGGACGTATAGCCAACACCTGG
ACACACACAGACCAAACTCTCCCTCCCTCCATCTCCAAACGCCTTAACCTCCCCCTTCACCGCCGTACCAAACAC
CATCACAAAATCAAAGGCCTCACCATCGACACCCAATTCCAAAAAACCGACCGTTCTAAATTCGGTGACGTCAAA
TTCGCAATTGTAGGCGCTAATGTGCCAGGAGCGAAAGCGTCGGAAGATTTGAATGTTAATGAACTTGGGGAGAGG
AAGAGGAATTTTGTTTATTCGAGGGTGTTTAGACATAGGAGGGGATTTGGTGATTTTATTGATGATGTGGGGGGT
GCTATAAGTGACGGCGCAGCAGCAGTGGGCGGTGCTATTAGTGATGGCGTGGGAGCAGTTGGCGAAGTTATAAGC
GACGGTGCGGGAGCAGTTGGTGGCGCTATTAGCGACGGTGCTGGCGCAGTTGGCGAAGTTATCAGCGATGGTGCC
GGCGCAGTGGGTGATGCTATAAGTGATGGCGCTGGTGCAGTTGGTGATGTTATTGATAACGTGGGCGGGGCTATC
AGTGACGGTGCTGACGCAGTAGGCGATGCTATCAGTGATGGCGCAGGGGCAGTAGGCGATGCTATCAGCGACGGC
GCACAAGCAGTCGGCGGTGCCATAGCCAATGGCGCCGAAGCAGTCAGCGACGCCCTTTCCGAACCCCAAGAAATC
AGCAAAACCTTTTCCGCCCCCTTCGACATCAGCAAAACCTTCACCGTCTTTGAACAAAACATCAAATGTTCAGCT
CCAATCACCAACACAAACACCTCATTCAATCCCAAAATCGGAGTAAATGGAAAACTCAAGGTCGATGTAGAGGCG
GATATACATGGAAATGTGGATATTAGTATTTTTGCGAGTGGATCGTTGACGGAATTGAAATTGGATAAATTCGAG
TTGAGCACTAGTGAGTTGATGATATCGGTTTGATTGGAAGGTCGCTCAATCGTTTTTTTTATAGGTTTGAATGCG
GATTTGAATGGGGCGATTATCTTGTCAGCCGGGGTGGGTGGGTCCATCGAATCCGGAAATATCAAGCTTTTCGAA
GTCGGTATACCCGGACTCGATTTTCCTGGGTAAGTGAAATATATAAATGAAGAATGACGTACTAACGATAGTCAA
ACAGGATATTCTCGATAGGACCAACGTTCCAAATCAACGCTAATGCCAAGGCGTCGTTGAACATTGACACGGATA
TGCGGATTGGCGTTGCATATCATATTGATAATGCCAAGTTTGATTTCCCGAATGGAGGAAAGAAAAGTGGATCGT
TTAGTGCTGGTGACACACGTATGTGAATTGAATCTCGAACACATGCAAGACACTTAACTTCATTTCAGCACTTCA
AATATCGGCGCAACCGTCATCTTCAGCAACAGGCACAGTTGAAGCGCATCTGATTCCAAGTCTGAACGTGGGTAT
AGATGCGTTTGGAGGAGTGGCCAAGGCGGGGGTGTTTGTGAATTTGGATGCGTCAGCAAGTGTGAGTTTGACGGT
GGATGCGACGGGGCCGGTTGTAGAAGGGAAAGTGAATCGGCGGGAAATGATGGTGCGGGGAGGGGGAGCTATGGG
AGCGTATTATTTTAATGATAAGCGGACGCCTGTACCTGAGCCATTTGGAATTGGGGATATTGTGGATGGGATCAA
GGATGGAGCGAAGAAGGCTGCGGGGGCGGTGAAGAGTGGGGCAAAGAAGGCTGCTGGTGCGGTCGAGAGCGGTGC
AAAAAAGGTTGTTGACGGAGCGAAAAAAGCAGTTGATAGTGGAGAGAAGAAAGTAGCTGGGGCGGTGAAAGAAGG
AGCGAAAAATATTGAAAAAGGTGCAAAGAAAGTGGGAGGAGCGGTTGAGGACGGGGCAAAGAAGATTGGCGGAGC
GGTCAAGGAGGGAGCAGAAAAAGTGGAAGAGGGTGCCAAGAAGGTCGCCAAAAAGGTTGAAGAGGGTGCCAAGAA
GGCGGGTAAAGTTGTGAAAGAGGGAGCCGAAAAGGTAGAAGAAGGCGCTAAGAAGGTTGTTAAAGAGGGCGCCAA
AAAGGTCGAGGAAGGAGCCAAGAAAGCAGGCAAAGCTGTGAAAGAGGGCGCCGAGAAGGTCGAGGAAGGTGCCAA
GAAGGTAGTCAAAGAGGGCGCCAAAAAAGTGGAAGAGGGAGCCAAGAAGGCAGGTAAAGTTGTTAAGGAGGGTGC
AGAAAAAGTTGAAGAAGGTGCGAAGAAGACGGGTAAGGCTGTGAAGGAGGGAGCCGAAAAGGTTGAGGAAGGCGC
CAAGAAGATAGTCAAAGAGGGAGCAGAGAAAGTGGAAGAGGCAGGTAAAGTTATTAAAGAAGGAGCAGAAAAGGT
CGGGGAGGTAGCCAAAGAGGGCGCCGAGAAGGTTGAGGAGGGCGTCAAGAAGGCAGGAAAAGTGATTGATGAAGG
CGCCAAGAAGATAGTCAACGAGGAAGTCGAGAAAGAAGGAGCAGAAAAAGTGGAGGAAGGTGCCAAGGAGGATGC
CAAGAAGGTAGATAACGAGGGTGCCAAGACAGGGGGAGCAACGGATGACGTCAGCTTTGGGGGATGCGTCGAAGT
GGGCGCGGGGTTGTCGGTGAACGTCGGAGCCGATGCAAGCTTTTTCGGGCTATTCGATCCGTTCAAGAAGATTCC
GCTGTTTGAGAAGCAGTTTTCGTTGCTCAAGGTATGTGGTTAGTGAGAATGATGTGCCTGTGCTGACTCGGGAGC
AGAAATGTTTTGGAGAACAGAAGCGACGGGACCTGAGTGTGGTGGGCCGGGGACTGACGTGTAATGGAGTGAATG
TTCGCGGGGTAGTCGAGTTGGTAAATGAGGTAGTGCAGTCACGTGTATGAGTAGGGAGATAAAGCAGTGCGGTGT
TTTGTTCTGTCCAGCCATGGAGGCGGTCTACCAAGTCAAGCTTCTCGCCGCCCTCAGATCAGGTTGGTCGTTATC
GACGGTTAGAACATCACACTCAGACTGTTGCAGGCGATCCAGCGCGGATCCACCCCTTTCTCGCTGAAATTGGCA
AGGACCGGTCGGTGTCGTCTCTCGACTGTTCAGCTGCTGCTCTCCACCTCGCCGTCCGATGTGCCTCCAGTGCGT
GTGTCGTTGTTAATTGACTTTTACTTACTGTGTTGCAGCGGAGACGGTCGCTCTTCTTCTCGCCCACCGCGCCAT
ATCGCCCAACGGTGTTCACCCCCCCGCCTCGGGCACCACGCCCCTCCACCTTGCCGCCTCCCTTGGCAGAGTCGA
CATCGTCACCCTCCTCCTTGACCAGGACGGCATCGACGACACCCTCCTCGACGACCAGCGCAAGTCCTGCCGCGA
CCTCGCAAAAACCAGAGACACCCTCAAAGCCATCGATGGTCTGTTCTCTTCTCTAACCCTCTTTACTACTAACCC
CCTATCCAGACTCACGCACCCTCCTCAATGCCTCCTACCGCTCGCTCCTCCGCTCCTACATCCTCTCCCCCTTCA
CCGACCCTCCCTCTCCTGCACTCCTCCACCTCCTCAGCGGACCCCGCACCTCTCTCATCAACCTCTCCTATCTCG
ACGACGATTCTGGTTCGTCTCTCTTGCACGAAGCCGCCAACAGAAAGGATCTCCGTCTCATCGAGCTCGCCGTCC
GCGCCGGCGCAGATGTCTTTGTCCGCAACCGCAGGGGAAAGATGGCTTATGAGATCGTCAAGGATGACAAGGTCA
AGGTATTCCTACGTCAATGTAAGTCTCTTTTTCTCCCCACACACCCTCACTCATCTCCTTCAGTCGCCAATCACG
ATCACTCCTTCATTCGATCCTCCTTTTCCGCTTCAGAACCACCCGCACTCAAGGGCTATCTCAACAAATACACCA
ACGTCGCCAGGGGCTACCACACCCGCTGGTTTGTCCTCGCTCATGGTGTCCTCTCATGCAAGTTCCTTCTCTTCC
CCTTCTCCCTCTTCTAATCCCTCTCTAGACTACCGTCACCAGCAAGACGAGTCTGTATCGTCTCGCGGTTCCATC
TCCATGAAATCCGCCATCGTCAAAATCAACGAACAACACCCCAATAGATTCGAAATCCAGTCCCGACTCGCTTCT
GCCTCGGTCCAAAAATGGTACATTAAAGCAAATCACCCTGTCGAAGCCGCACGTTGGATTCTCGCTCTCAACAAA
AGCATAGAATGGGCTAGAGCCGCACCGGAACCTCCTAGATCCAGTGCTGAAAGGAGTATTGCAGAGTCCGATTCC
ATCCATGCTGCCCTCAGTACGGATCCTAATTTGTCGGATTTGAATCCGGATGACGATGAGGAAGAGGGGACGAGG
ATGCCGACGGATGATGCGTCTTCGATGGGGATGGTGTCTCGTCATGACGACATTTATGAACTTCAAGGAAACTCG
ATTTTGGCTCAGCTGGAGATGACACAGCGGTTGCTCGTGTCTTATTTTGGAGGGTCGACGTCCTCTGCGCGGTCA
ATCAGTTCGACTACTTCGACGAGTCACGAAATCAAGTCTACTATCCTTGAATCCATGTCTACCCTGTCTACTCTT
GCACAAGAATACACCTCCATGTCGAAAGACCGTGAACAGTGTTTTCAGAAGGCGCTCGCTCAGGAAAAAGCGAGA
CAGAAGGTGTGGGAAGAGTCCTTGGCGACGGTCGTCAGAGAGGGGGCGACGTTGGAAGAAGAGTTGAGGAATAGG
AGTAGGAAGAGGGGGTCTAAAATTTTTGGACCTGGGGAAGGGTTTGTTGCCGCTTTGAGTGGCATTGGGGAGGAG
AAGGAAAGTGCTTTGGGAGTGACCTTGGTAGCTTCCCCTCCTGCCATTGACAGTCCGTGGAAAGAGTCGCCGTTG
GCGGAACCCGTTCGACCACGAACGTCGACGAATGAAACCGTGAAACCGCGTCAGGATGGGGATTCGGATGAAGAA
GACGAGGAAGATGAATTTTTCGATGCGATTGATTCGAACAATCTACCTAATCTCGTTGTCCCTCCTTCCCTTGCC
GTCATCTCCCCCACCACCTCTCCTCATCCAGCCTCCCCCACCAAAGTCAAACTACCGCCGACAGCACAGATTCAA
CCGCCACCCCTATCCCCTGCATCTATACCGTCGTTTATTGACATGGGACCCTACAAGGGGTATGAGGTGTTGAGG
ACCAAATTGGGATTGATGGACGATGAGAGGCCGCCGACGAGTTTGTGGAGTGTGTTGAAACATTCGATTGGGAAG
GATTTGACGAGGATTAGTTTTCCCGTCTTTTTTAATGAGCCGACGAGTATGTTGCAGAGGATGGCGGAGGATATG
GAGTTTAGTGAGTGTTTGGATACGGCCGCGACGGAGATGGAGTCGTTGAAGAGGTTGGCTTATGTTGCTGCTTTT
GCGATGAGTAATTATTCGAGTACGATTGGGAGGATTGCGAAACCGTTTAATCCGATGTTGGTGAGTCGCGGTTTT
GTTTATATCTGATGAGGGTTGACACCTCTTTGAAAGAGCGAGACGTTTGAGTATGTGAGGTTGGACAAGAAATAT
CGATATGTGTCGGAACAAGTCAGTCATCATCCACCGATTTCGGCGTGTTGGGCAGAATCGCCTTTGTGGCATTAT
TTTGGAGAGGTGGATGCGCAAAACAAGTTTATGGGTAAATCGTTTGAGATTAGACCTACGGGTGTGGCGCATGCT
GAATTGATTTTACCGGAATCGTGGGTGGAGGAGGATAAGAAAGGGTATAGAAAGGCGCAAGGGGTGTGTGGGGGA
GAGGGAAAGGTGGTGGAACATTATACGTGGAAGAAAGTGACGACGAATGTGTCGGGGTTTATTTTGGGGAGTCCG
ACGATTGATCATTATGGAGATATGACTGTGAGTTTCTCTCGCTGTACGATACGATGGTGGTTGACACTTTTACAA
GGTGGTGAATCATGCTACGAATGAGAAATGTGTATTGACGTTTAAACCACGTGGATGGAGGGGTAAAGATGCGTA
TGAGATTGCGGGACAGGTGTTGGATGCGAAAGGGAGGGCTGTGTATGAGATTGCGGGGAGGTGGAATTCGCAGTT
GATTATGAGGCCTGTGGGGAGTGGGGGAGTGTTGCATCCTGATACGACAGTGTCGTCTTCGTCTTTGGATGATTT
GGAACTCAACACCACAAACAACAACACCAACAACAGTCCGGAATATACTCTGCTATGGAAAAACTCACCGAAACC
GATTGGGTCTCCGTTCAATTTGACACCGTTTGCGATTACGTTGAATGAATGTTCGAAAGAGACGCTTTTACCGTT
TTTGTGTCCGACGGATTGTAGATTGAGACCGGATCAGAGGGCGTTTGAGATGGGGAAATATGATTTGGCGAATGA
GTTGAAGATGAGGCAGGAGGAGAGGCAGAGGGGGACGAGGAAGGAGAGGGAGATGGGGGTTAAGGGGGAACATAG
GCCTAGGTGGTTTGAGGCGAGGACGGATGGGGATACGGGGGAGAGGGTGTGGATGCCGAAGAAGGTGATGGTGGA
GTTTAGGGTGGGGAGTGAGGAAGAGGGGGAGGATAAGGAGGTGAGGAGGAGGAGGGAGGAGGAGGTTGAGTATTG
GGCGGAGAGGGAGAGGGTTTGGAGGGAGGGTGGGTTTAAGAGGTGGAAGGATGTGGAGGAGATATTTGTGGAGGA
GCCGGAGGTTTTGAGGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail