Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|033230
Gene name
Locationscaffold_12:1396624..1397270
Strand-
Gene length (bp)646
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.8E-24 45 103
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 3.6E-16 27 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P62877|RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens GN=RBX1 PE=1 SV=1 1 112 7.0E-60
sp|P62878|RBX1_MOUSE E3 ubiquitin-protein ligase RBX1 OS=Mus musculus GN=Rbx1 PE=1 SV=1 1 112 7.0E-60
sp|Q8QG64|RBX1_SALSA RING-box protein 1 OS=Salmo salar GN=rbx1 PE=2 SV=2 1 112 4.0E-59
sp|Q9W5E1|RBX1A_DROME RING-box protein 1A OS=Drosophila melanogaster GN=Roc1a PE=1 SV=1 5 112 2.0E-56
sp|Q940X7|RBX1A_ARATH RING-box protein 1a OS=Arabidopsis thaliana GN=RBX1A PE=1 SV=1 9 113 3.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P62877|RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens GN=RBX1 PE=1 SV=1 1 112 7.0E-60
sp|P62878|RBX1_MOUSE E3 ubiquitin-protein ligase RBX1 OS=Mus musculus GN=Rbx1 PE=1 SV=1 1 112 7.0E-60
sp|Q8QG64|RBX1_SALSA RING-box protein 1 OS=Salmo salar GN=rbx1 PE=2 SV=2 1 112 4.0E-59
sp|Q9W5E1|RBX1A_DROME RING-box protein 1A OS=Drosophila melanogaster GN=Roc1a PE=1 SV=1 5 112 2.0E-56
sp|Q940X7|RBX1A_ARATH RING-box protein 1a OS=Arabidopsis thaliana GN=RBX1A PE=1 SV=1 9 113 3.0E-54
sp|Q54K33|RBX1_DICDI RING-box protein 1 OS=Dictyostelium discoideum GN=rbx1 PE=3 SV=1 13 113 4.0E-54
sp|O13959|RBX1_SCHPO RING-box protein pip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pip1 PE=1 SV=2 1 112 5.0E-52
sp|Q23457|RBX1_CAEEL RING-box protein 1 OS=Caenorhabditis elegans GN=rbx-1 PE=1 SV=1 2 112 4.0E-51
sp|Q9M2B0|RBX1B_ARATH RING-box protein 1b OS=Arabidopsis thaliana GN=RBX1B PE=2 SV=1 7 113 5.0E-51
sp|Q08273|RBX1_YEAST RING-box protein HRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRT1 PE=1 SV=1 3 113 3.0E-42
sp|Q9NHX0|RBX1B_DROME RING-box protein 1B OS=Drosophila melanogaster GN=Roc1b PE=2 SV=2 26 113 1.0E-40
sp|Q9UBF6|RBX2_HUMAN RING-box protein 2 OS=Homo sapiens GN=RNF7 PE=1 SV=1 27 113 3.0E-24
sp|Q9WTZ1|RBX2_MOUSE RING-box protein 2 OS=Mus musculus GN=Rnf7 PE=3 SV=1 27 113 4.0E-24
sp|Q54L48|APC11_DICDI Anaphase-promoting complex subunit 11 OS=Dictyostelium discoideum GN=anapc11 PE=3 SV=1 32 109 2.0E-14
sp|Q9M9L0|APC11_ARATH Anaphase-promoting complex subunit 11 OS=Arabidopsis thaliana GN=APC11 PE=1 SV=2 26 110 2.0E-14
sp|Q3ZCF6|APC11_BOVIN Anaphase-promoting complex subunit 11 OS=Bos taurus GN=ANAPC11 PE=3 SV=1 26 110 1.0E-13
sp|Q9CPX9|APC11_MOUSE Anaphase-promoting complex subunit 11 OS=Mus musculus GN=Anapc11 PE=3 SV=1 26 110 4.0E-13
sp|Q5R8A2|APC11_PONAB Anaphase-promoting complex subunit 11 OS=Pongo abelii GN=ANAPC11 PE=3 SV=1 26 110 4.0E-13
sp|Q9NYG5|APC11_HUMAN Anaphase-promoting complex subunit 11 OS=Homo sapiens GN=ANAPC11 PE=1 SV=1 26 110 4.0E-13
sp|Q5UQ40|UBC4_MIMIV Probable bifunctional E2/E3 enzyme R795 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R795 PE=3 SV=1 46 108 1.0E-09
sp|Q9UT86|APC11_SCHPO Anaphase-promoting complex subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc11 PE=1 SV=1 26 106 2.0E-09
sp|Q20052|APC11_CAEEL Anaphase-promoting complex subunit 11 OS=Caenorhabditis elegans GN=apc-11 PE=1 SV=1 20 108 6.0E-08
sp|Q12157|APC11_YEAST Anaphase-promoting complex subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC11 PE=1 SV=1 45 110 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005575 cellular_component No
GO:0140535 intracellular protein-containing complex No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1990234 transferase complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0030163 protein catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0032991 protein-containing complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0044260 cellular macromolecule metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0004842 ubiquitin-protein transferase activity No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0010498 proteasomal protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0005515 protein binding No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0140513 nuclear protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|033230
MADAMEVDGEPKTKSKKEGKDSGKARFEVKKWNAVSLWAWDIVVDNCAICRNHIMDLCIDCQANQVSATSEECNA
AWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR*
Coding >AgabiH97|033230
ATGGCCGACGCAATGGAAGTTGATGGTGAACCAAAGACCAAATCCAAGAAAGAAGGCAAAGACAGTGGCAAGGCG
CGCTTTGAAGTTAAGAAGTGGAATGCTGTTTCGTTGTGGGCATGGGACATCGTCGTCGACAATTGCGCCATCTGC
AGGAACCACATTATGGACTTATGCATTGATTGTCAAGCCAATCAGGTTTCCGCCACAAGTGAAGAATGTAATGCA
GCGTGGGGTATCTGCAACCACGCCTTTCACTTCCACTGTATCTCCCGATGGCTCAAAACGCGTAATGTATGCCCC
CTTGACAATAGAGAATGGGAGCTGCAGAAATATGGTCGTTAG
Transcript >AgabiH97|033230
ATGGCCGACGCAATGGAAGTTGATGGTGAACCAAAGACCAAATCCAAGAAAGAAGGCAAAGACAGTGGCAAGGCG
CGCTTTGAAGTTAAGAAGTGGAATGCTGTTTCGTTGTGGGCATGGGACATCGTCGTCGACAATTGCGCCATCTGC
AGGAACCACATTATGGACTTATGCATTGATTGTCAAGCCAATCAGGTTTCCGCCACAAGTGAAGAATGTAATGCA
GCGTGGGGTATCTGCAACCACGCCTTTCACTTCCACTGTATCTCCCGATGGCTCAAAACGCGTAATGTATGCCCC
CTTGACAATAGAGAATGGGAGCTGCAGAAATATGGTCGTTAG
Gene >AgabiH97|033230
ATGGCCGACGCAATGGAAGTTGATGGTGAACCAAAGACCAAATCCAAGAAAGAAGGCAAAGACAGTGGCAAGGCG
CGCTTTGAAGTTAAGAAGGTGCTGGATCTCTCGTTGTAAACGATGACCTCGTGTTGCTTATTCTTTTCTGCCATT
AGTGGAATGCTGTTTCGTTGTGGGCATGGGGTGAGTTATATCTACGCCCTGGTGAGATGGTTTTGATGCTCACAA
GGCCTCATTTTCTAGACATCGTCGTCGACAATTGCGCCATCTGCAGGAACCACATTATGGACTTATGTGGGTCGT
TATTTTCTGTCGAGGGCTCAATTCCTAATCTTGATCGTTCATCATCATTTGCGTCAATGAAAAGGCATTGATTGT
CAAGCCAATCAGGTTTCCGCCACAAGTGAAGAATGTAATGCAGCGTGGGGTATCTGCAACGTGCGTTGTCGCTCC
TTTCATTGTAGTGCTTTGCTTATCATTCTTTTTGAACGTTCTAGCACGCCTTTCACTTCCACTGTATCTCCCGAT
GGCTCAAAACGCGTAATGTATGCCCCCTTGACAATAGAGAATGGGAGCTGCAGAAGTAAGCATTTACTGATAACA
GCCCCAATGAAACTATGCTGACCCGTTCCCCAGATATGGTCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail