Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|033050
Gene name
Locationscaffold_12:1346496..1349751
Strand-
Gene length (bp)3255
Transcript length (bp)3201
Coding sequence length (bp)3201
Protein length (aa) 1067

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13650 Asp_protease_2 Aspartyl protease 1.1E-05 933 1020
PF08284 RVP_2 Retroviral aspartyl protease 7.3E-06 925 1038

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|033050
MNPDTKWKAQIFGPDNEEQRATSREPRSTSPLIYGTRRRGRMPPAPTKPRASRSAPFPLRDATWSSFDQGGPSRM
EEDTMRETREEGLPLPRIEDWGTAESDKTLTNIGSQVGEEVEEQREDVERRSSQTPPTKLDKGKAREASPQIEDG
LVEDTMFELLGITDPERAAHIRKKAMEITDEAFKAAGMEANQTSKKYIEIFRRNIHRLAEIYGNLKDNKSPGGET
PMERLGERYHEKWNNERPATSQGAVEQPATTLLPPIQMGIHQPQPQHPIQIKTEYATSVGTSMDTLGKAYKSLYE
PPRENESARQYKTRLEAQERHRSISMTMNEPKVPIEVRRAKSPTRGTLPVVHFGPGQRNEKIEQENNSSTYEYDN
HRRLLTSPARPLPIPPMIPKTYNPIKPTSEQSNGGCYSFIAPGPSSQQIPHESTLKNPNLDTIRPHKEKLMFETK
PESNRQYSFKNYAPAEEYQTPRTQRGLSLARGMSVPMIGGIAEAIEQHQERMHERLRSIIQYYLEEPTQVPKGYK
LNSSRLPSDGGIEPYKGSPKFIILERFVTAVSIDFALRGLAGTGRICDRLRNMHLPYYLQAEAKDLETIIALYDR
FVLPTSTQEAKEKLSRLRYDARYGVQTFYDSIKKCAAQMNTYPEDHYLNDIFIKGIPSDMQEELILKYGMRPELN
TLEEFLKCAANYENRKWLYGYYEKSLKLNTNNDRTYERRRYEKKGERSAPRGARSQPKDNDREPRKWKDYTKPFK
PKHEQPAKLDLKDRIGGYAKDSKYEKKNRTESNKRKYNNDKKENKWKRKDQLKAIQLEAEEQESGYEAMSDESDY
DSLYSREKQRSQIMKIGEVDESEQLTEAEDTELEIEENHEWNEDRYESSENERLNALSVTPTRKAKNETREHDEN
HVKMRKVTLKKNKEKIERPKYTREAKQCMASLVKIGGLEAWALWDSGSTTTGITPALAQLAKIRVSELSESHILQ
LGTVGSRSTIKYGTNTKFEIEGIQFKTYADIANFDRYDAIIGTPFMRMNNVKLDFENNEIIIRGRRVPALTITLE
NEARARRYRTTEQVQK*
Coding >AgabiH97|033050
ATGAACCCCGACACGAAATGGAAAGCCCAGATCTTCGGACCTGACAACGAAGAACAACGAGCGACGTCTAGAGAA
CCGCGTTCGACTTCACCTCTGATCTACGGAACAAGGAGAAGAGGAAGGATGCCTCCCGCTCCGACAAAACCACGA
GCATCACGAAGTGCACCGTTCCCGTTGCGTGACGCCACGTGGTCGAGCTTCGACCAAGGAGGACCGAGCCGAATG
GAAGAGGACACGATGAGGGAGACGAGAGAGGAAGGACTACCCCTACCGAGGATAGAGGATTGGGGTACAGCGGAA
TCCGATAAAACACTGACCAATATCGGCAGTCAAGTAGGAGAAGAAGTAGAGGAACAACGAGAGGACGTTGAAAGG
AGATCGAGTCAGACGCCACCAACGAAATTAGACAAAGGAAAAGCGAGGGAAGCGTCCCCGCAGATAGAAGATGGA
CTAGTAGAGGATACTATGTTCGAGTTGCTAGGAATAACAGACCCGGAGAGGGCTGCACATATACGAAAAAAGGCA
ATGGAAATAACAGACGAAGCATTTAAGGCAGCTGGCATGGAAGCCAACCAAACGTCGAAAAAATACATTGAGATT
TTTAGAAGAAATATACATCGATTAGCCGAAATCTACGGTAACTTAAAAGACAACAAATCACCCGGGGGTGAAACG
CCTATGGAACGGCTAGGAGAAAGATACCATGAGAAATGGAATAACGAGAGACCAGCAACGAGTCAAGGAGCCGTG
GAACAACCGGCAACCACGTTACTACCCCCAATACAAATGGGAATACACCAGCCACAACCACAGCATCCAATCCAA
ATAAAAACGGAGTATGCTACGTCCGTAGGAACATCCATGGACACATTAGGAAAAGCATATAAATCATTATACGAA
CCCCCACGCGAGAACGAATCAGCTAGACAATATAAAACACGATTGGAAGCTCAAGAGAGACACAGATCGATAAGC
ATGACTATGAACGAACCGAAGGTACCGATAGAAGTGCGAAGGGCTAAGAGTCCGACGAGGGGAACACTACCCGTT
GTACACTTCGGACCAGGACAACGTAACGAAAAAATTGAACAAGAAAACAATTCCTCGACATATGAGTATGATAAC
CATCGGAGACTACTCACGTCACCAGCGAGACCGTTACCAATACCACCAATGATACCAAAAACATATAATCCGATC
AAACCAACTTCAGAACAATCTAATGGAGGATGTTATTCGTTCATAGCCCCTGGACCATCATCACAACAAATACCA
CATGAATCTACACTAAAAAATCCGAACTTGGATACTATACGACCACATAAGGAGAAATTAATGTTTGAAACGAAA
CCAGAAAGTAATAGACAATATAGTTTCAAAAATTATGCACCGGCGGAAGAATATCAAACCCCGAGAACTCAAAGA
GGACTATCATTGGCTAGAGGAATGTCCGTACCGATGATAGGAGGAATAGCAGAAGCGATTGAGCAACATCAAGAA
AGGATGCACGAGAGGCTACGAAGCATCATCCAATATTATCTAGAGGAACCAACACAGGTCCCAAAAGGTTATAAA
TTAAATTCATCGAGACTACCTAGTGACGGGGGAATTGAGCCCTATAAGGGTAGTCCAAAGTTCATCATATTGGAA
CGATTCGTAACAGCAGTATCCATCGACTTCGCATTGAGAGGACTAGCAGGAACAGGAAGAATATGCGATCGATTA
CGCAATATGCATCTACCATATTACCTACAAGCGGAAGCGAAAGACTTAGAGACCATTATCGCACTATACGATCGA
TTCGTACTACCAACGTCTACTCAAGAAGCTAAAGAGAAACTTTCACGCCTGAGATATGATGCACGCTATGGCGTA
CAAACTTTCTATGATTCAATCAAAAAATGTGCAGCGCAGATGAACACTTACCCAGAAGATCATTACCTTAACGAT
ATATTTATCAAAGGTATACCATCAGATATGCAGGAAGAATTAATATTAAAATACGGAATGAGACCGGAGTTAAAC
ACACTAGAAGAATTCCTAAAGTGCGCAGCCAACTATGAGAATAGGAAATGGTTATATGGATACTATGAGAAATCA
TTGAAACTAAATACAAACAATGACCGAACGTACGAACGACGTAGATATGAAAAGAAAGGTGAACGAAGCGCCCCA
CGAGGAGCAAGATCACAACCCAAAGACAATGATAGAGAACCGCGGAAATGGAAAGACTACACGAAACCATTTAAA
CCAAAGCATGAACAACCAGCCAAACTAGACCTCAAGGACAGAATAGGCGGATACGCTAAAGATTCGAAATACGAG
AAAAAGAATAGAACAGAGTCGAACAAACGAAAATATAATAACGATAAAAAGGAGAACAAATGGAAAAGAAAAGAT
CAACTAAAAGCCATCCAATTGGAGGCGGAGGAACAGGAATCAGGATACGAAGCAATGAGCGATGAATCAGACTAC
GATTCATTATACTCACGAGAAAAACAACGATCACAAATTATGAAAATAGGAGAAGTAGACGAGAGTGAACAACTA
ACAGAAGCGGAGGATACTGAATTGGAAATAGAAGAAAACCACGAATGGAATGAAGATCGATACGAATCATCAGAA
AACGAGAGATTGAATGCGTTGTCCGTAACGCCAACGAGAAAAGCGAAAAATGAGACTAGAGAACACGACGAAAAT
CACGTAAAAATGAGGAAAGTAACGCTAAAGAAGAATAAAGAAAAGATAGAGAGACCGAAATATACGCGTGAAGCG
AAACAATGCATGGCGTCACTGGTAAAGATAGGAGGCCTAGAAGCATGGGCACTCTGGGACTCAGGCAGTACTACC
ACAGGTATAACACCTGCTCTGGCTCAGTTAGCAAAAATCCGAGTGAGTGAACTATCCGAATCGCACATACTCCAA
CTGGGGACAGTGGGTAGTCGATCAACAATAAAATATGGTACAAATACCAAATTTGAAATAGAAGGAATACAATTT
AAAACCTATGCAGACATAGCCAACTTTGACAGATACGACGCTATAATAGGCACCCCCTTCATGCGAATGAATAAC
GTAAAACTAGACTTCGAGAACAACGAAATAATAATTCGAGGTAGACGCGTTCCAGCACTAACGATCACCTTGGAA
AACGAGGCACGCGCAAGGAGATATCGAACTACGGAACAAGTGCAAAAATGA
Transcript >AgabiH97|033050
ATGAACCCCGACACGAAATGGAAAGCCCAGATCTTCGGACCTGACAACGAAGAACAACGAGCGACGTCTAGAGAA
CCGCGTTCGACTTCACCTCTGATCTACGGAACAAGGAGAAGAGGAAGGATGCCTCCCGCTCCGACAAAACCACGA
GCATCACGAAGTGCACCGTTCCCGTTGCGTGACGCCACGTGGTCGAGCTTCGACCAAGGAGGACCGAGCCGAATG
GAAGAGGACACGATGAGGGAGACGAGAGAGGAAGGACTACCCCTACCGAGGATAGAGGATTGGGGTACAGCGGAA
TCCGATAAAACACTGACCAATATCGGCAGTCAAGTAGGAGAAGAAGTAGAGGAACAACGAGAGGACGTTGAAAGG
AGATCGAGTCAGACGCCACCAACGAAATTAGACAAAGGAAAAGCGAGGGAAGCGTCCCCGCAGATAGAAGATGGA
CTAGTAGAGGATACTATGTTCGAGTTGCTAGGAATAACAGACCCGGAGAGGGCTGCACATATACGAAAAAAGGCA
ATGGAAATAACAGACGAAGCATTTAAGGCAGCTGGCATGGAAGCCAACCAAACGTCGAAAAAATACATTGAGATT
TTTAGAAGAAATATACATCGATTAGCCGAAATCTACGGTAACTTAAAAGACAACAAATCACCCGGGGGTGAAACG
CCTATGGAACGGCTAGGAGAAAGATACCATGAGAAATGGAATAACGAGAGACCAGCAACGAGTCAAGGAGCCGTG
GAACAACCGGCAACCACGTTACTACCCCCAATACAAATGGGAATACACCAGCCACAACCACAGCATCCAATCCAA
ATAAAAACGGAGTATGCTACGTCCGTAGGAACATCCATGGACACATTAGGAAAAGCATATAAATCATTATACGAA
CCCCCACGCGAGAACGAATCAGCTAGACAATATAAAACACGATTGGAAGCTCAAGAGAGACACAGATCGATAAGC
ATGACTATGAACGAACCGAAGGTACCGATAGAAGTGCGAAGGGCTAAGAGTCCGACGAGGGGAACACTACCCGTT
GTACACTTCGGACCAGGACAACGTAACGAAAAAATTGAACAAGAAAACAATTCCTCGACATATGAGTATGATAAC
CATCGGAGACTACTCACGTCACCAGCGAGACCGTTACCAATACCACCAATGATACCAAAAACATATAATCCGATC
AAACCAACTTCAGAACAATCTAATGGAGGATGTTATTCGTTCATAGCCCCTGGACCATCATCACAACAAATACCA
CATGAATCTACACTAAAAAATCCGAACTTGGATACTATACGACCACATAAGGAGAAATTAATGTTTGAAACGAAA
CCAGAAAGTAATAGACAATATAGTTTCAAAAATTATGCACCGGCGGAAGAATATCAAACCCCGAGAACTCAAAGA
GGACTATCATTGGCTAGAGGAATGTCCGTACCGATGATAGGAGGAATAGCAGAAGCGATTGAGCAACATCAAGAA
AGGATGCACGAGAGGCTACGAAGCATCATCCAATATTATCTAGAGGAACCAACACAGGTCCCAAAAGGTTATAAA
TTAAATTCATCGAGACTACCTAGTGACGGGGGAATTGAGCCCTATAAGGGTAGTCCAAAGTTCATCATATTGGAA
CGATTCGTAACAGCAGTATCCATCGACTTCGCATTGAGAGGACTAGCAGGAACAGGAAGAATATGCGATCGATTA
CGCAATATGCATCTACCATATTACCTACAAGCGGAAGCGAAAGACTTAGAGACCATTATCGCACTATACGATCGA
TTCGTACTACCAACGTCTACTCAAGAAGCTAAAGAGAAACTTTCACGCCTGAGATATGATGCACGCTATGGCGTA
CAAACTTTCTATGATTCAATCAAAAAATGTGCAGCGCAGATGAACACTTACCCAGAAGATCATTACCTTAACGAT
ATATTTATCAAAGGTATACCATCAGATATGCAGGAAGAATTAATATTAAAATACGGAATGAGACCGGAGTTAAAC
ACACTAGAAGAATTCCTAAAGTGCGCAGCCAACTATGAGAATAGGAAATGGTTATATGGATACTATGAGAAATCA
TTGAAACTAAATACAAACAATGACCGAACGTACGAACGACGTAGATATGAAAAGAAAGGTGAACGAAGCGCCCCA
CGAGGAGCAAGATCACAACCCAAAGACAATGATAGAGAACCGCGGAAATGGAAAGACTACACGAAACCATTTAAA
CCAAAGCATGAACAACCAGCCAAACTAGACCTCAAGGACAGAATAGGCGGATACGCTAAAGATTCGAAATACGAG
AAAAAGAATAGAACAGAGTCGAACAAACGAAAATATAATAACGATAAAAAGGAGAACAAATGGAAAAGAAAAGAT
CAACTAAAAGCCATCCAATTGGAGGCGGAGGAACAGGAATCAGGATACGAAGCAATGAGCGATGAATCAGACTAC
GATTCATTATACTCACGAGAAAAACAACGATCACAAATTATGAAAATAGGAGAAGTAGACGAGAGTGAACAACTA
ACAGAAGCGGAGGATACTGAATTGGAAATAGAAGAAAACCACGAATGGAATGAAGATCGATACGAATCATCAGAA
AACGAGAGATTGAATGCGTTGTCCGTAACGCCAACGAGAAAAGCGAAAAATGAGACTAGAGAACACGACGAAAAT
CACGTAAAAATGAGGAAAGTAACGCTAAAGAAGAATAAAGAAAAGATAGAGAGACCGAAATATACGCGTGAAGCG
AAACAATGCATGGCGTCACTGGTAAAGATAGGAGGCCTAGAAGCATGGGCACTCTGGGACTCAGGCAGTACTACC
ACAGGTATAACACCTGCTCTGGCTCAGTTAGCAAAAATCCGAGTGAGTGAACTATCCGAATCGCACATACTCCAA
CTGGGGACAGTGGGTAGTCGATCAACAATAAAATATGGTACAAATACCAAATTTGAAATAGAAGGAATACAATTT
AAAACCTATGCAGACATAGCCAACTTTGACAGATACGACGCTATAATAGGCACCCCCTTCATGCGAATGAATAAC
GTAAAACTAGACTTCGAGAACAACGAAATAATAATTCGAGGTAGACGCGTTCCAGCACTAACGATCACCTTGGAA
AACGAGGCACGCGCAAGGAGATATCGAACTACGGAACAAGTGCAAAAATGA
Gene >AgabiH97|033050
ATGAACCCCGACACGAAATGGAAAGCCCAGATCTTCGGACCTGACAACGAAGAACAACGAGCGACGTCTAGAGAA
CCGCGTTCGACTTCACCTCTGATCTACGGAACAAGGAGAAGAGGAAGGATGCCTCCCGCTCCGACAAAACCACGA
GCATCACGAAGTGCACCGTTCCCGTTGCGTGACGCCACGTGGTCGAGCTTCGACCAAGGAGGACCGAGCCGAATG
GAAGAGGACACGATGAGGGAGACGAGAGAGGAAGGACTACCCCTACCGAGGATAGAGGATTGGGGTACAGCGGAA
TCCGATAAAACACTGACCAATATCGGCAGTCAAGTAGGAGAAGAAGTAGAGGAACAACGAGAGGACGTTGAAAGG
AGATCGAGTCAGACGCCACCAACGAAATTAGACAAAGGAAAAGCGAGGGAAGCGTCCCCGCAGATAGAAGATGGA
CTAGTAGAGGATACTATGTTCGAGTTGCTAGGAATAACAGACCCGGAGAGGGCTGCACATATACGAAAAAAGGCA
ATGGAAATAACAGACGAAGCATTTAAGGCAGCTGGCATGGAAGCCAACCAAACGTCGAAAAAATACATTGAGATT
TTTAGAAGAAATATACATCGATTAGCCGAAATCTACGGTAACTTAAAAGACAACAAATCACCCGGGGGTGAAACG
CCTATGGAACGGCTAGGAGAAAGATACCATGAGAAATGGAATAACGAGAGACCAGCAACGAGTCAAGGAGCCGTG
GAACAACCGGCAACCACGTTACTACCCCCAATACAAATGGGAATACACCAGCCACAACCACAGCATCCAATCCAA
ATAAAAACGGAGTATGCTACGTCCGTAGGAACATCCATGGACACATTAGGAAAAGCATATAAATCATTATACGAA
CCCCCACGCGAGAACGAATCAGCTAGACAATATAAAACACGATTGGAAGCTCAAGAGAGACACAGATCGATAAGC
ATGACTATGAACGAACCGAAGGTACCGATAGAAGTGCGAAGGGCTAAGAGTCCGACGAGGGGAACACTACCCGTT
GTACACTTCGGACCAGGACAACGTAACGAAAAAATTGAACAAGAAAACAATTCCTCGACATATGAGTATGATAAC
CATCGGAGACTACTCACGTCACCAGCGAGACCGTTACCAATACCACCAATGATACCAAAAACATATAATCCGATC
AAACCAACTTCAGAACAATCTAATGGAGGATGTTATTCGTTCATAGCCCCTGGACCATCATCACAACAAATACCA
CATGAATCTACACTAAAAAATCCGAACTTGGATACTATACGACCACATAAGGAGAAATTAATGTTTGAAACGAAA
CCAGAAAGTAATAGACAATATAGTTTCAAAAATTATGCACCGGCGGAAGAATATCAAACCCCGAGAACTCAAAGA
GGACTATCATTGGCTAGAGGAATGTCCGTACCGATGATAGGAGGAATAGCAGAAGCGATTGAGCAACATCAAGAA
AGGATGCACGAGAGGCTACGAAGCATCATCCAATATTATCTAGAGGAACCAACACAGGTCCCAAAAGGTTATAAA
TTAAATTCATCGAGACTACCTAGTGACGGGGGAATTGAGCCCTATAAGGGTAGTCCAAAGTTCATCATATTGGAA
CGATTCGTAACAGCAGTATCCATCGACTTCGCATTGAGAGGACTAGCAGGAACAGGAAGAATATGCGATCGATTA
CGCAATATGCATCTACCATATTACCTACAAGCGGAAGCGAAAGACTTAGTAATGGAACATGTATTGGGCAGTTTA
TGAGAAAAAACGGAATGGACATTTGAGGAGACCATTATCGCACTATACGATCGATTCGTACTACCAACGTCTACT
CAAGAAGCTAAAGAGAAACTTTCACGCCTGAGATATGATGCACGCTATGGCGTACAAACTTTCTATGATTCAATC
AAAAAATGTGCAGCGCAGATGAACACTTACCCAGAAGATCATTACCTTAACGATATATTTATCAAAGGTATACCA
TCAGATATGCAGGAAGAATTAATATTAAAATACGGAATGAGACCGGAGTTAAACACACTAGAAGAATTCCTAAAG
TGCGCAGCCAACTATGAGAATAGGAAATGGTTATATGGATACTATGAGAAATCATTGAAACTAAATACAAACAAT
GACCGAACGTACGAACGACGTAGATATGAAAAGAAAGGTGAACGAAGCGCCCCACGAGGAGCAAGATCACAACCC
AAAGACAATGATAGAGAACCGCGGAAATGGAAAGACTACACGAAACCATTTAAACCAAAGCATGAACAACCAGCC
AAACTAGACCTCAAGGACAGAATAGGCGGATACGCTAAAGATTCGAAATACGAGAAAAAGAATAGAACAGAGTCG
AACAAACGAAAATATAATAACGATAAAAAGGAGAACAAATGGAAAAGAAAAGATCAACTAAAAGCCATCCAATTG
GAGGCGGAGGAACAGGAATCAGGATACGAAGCAATGAGCGATGAATCAGACTACGATTCATTATACTCACGAGAA
AAACAACGATCACAAATTATGAAAATAGGAGAAGTAGACGAGAGTGAACAACTAACAGAAGCGGAGGATACTGAA
TTGGAAATAGAAGAAAACCACGAATGGAATGAAGATCGATACGAATCATCAGAAAACGAGAGATTGAATGCGTTG
TCCGTAACGCCAACGAGAAAAGCGAAAAATGAGACTAGAGAACACGACGAAAATCACGTAAAAATGAGGAAAGTA
ACGCTAAAGAAGAATAAAGAAAAGATAGAGAGACCGAAATATACGCGTGAAGCGAAACAATGCATGGCGTCACTG
GTAAAGATAGGAGGCCTAGAAGCATGGGCACTCTGGGACTCAGGCAGTACTACCACAGGTATAACACCTGCTCTG
GCTCAGTTAGCAAAAATCCGAGTGAGTGAACTATCCGAATCGCACATACTCCAACTGGGGACAGTGGGTAGTCGA
TCAACAATAAAATATGGTACAAATACCAAATTTGAAATAGAAGGAATACAATTTAAAACCTATGCAGACATAGCC
AACTTTGACAGATACGACGCTATAATAGGCACCCCCTTCATGCGAATGAATAACGTAAAACTAGACTTCGAGAAC
AACGAAATAATAATTCGAGGTAGACGCGTTCCAGCACTAACGATCACCTTGGAAAACGAGGCACGCGCAAGGAGA
TATCGAACTACGGAACAAGTGCAAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail