Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|032780
Gene name
Locationscaffold_12:1275229..1276747
Strand+
Gene length (bp)1518
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 1.6E-08 58 124
PF02469 Fasciclin Fasciclin domain 8.6E-19 251 378

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B388|FLA_ARTBC Fasciclin-like arabinogalactan protein ARB_02922 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02922 PE=3 SV=1 213 377 8.0E-08
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 262 399 6.0E-07
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 217 399 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|032780
MFSSVAFTLLTVALPTVLAQSSDSGYVQGLVNELNAIGYSGAANALSRANGTSSGQQFLSQVQDGNYTVFVPNNA
AFENLPSNVTSDDDLVAQYLAYHFVYGSFQNTSTTNSSSGGGGGTTSSASASESSSTASSTEAFAWYQRRDEVSN
SSDALLSGIYPNTTIGRTLLNSSDLVQLEANKSQVLAWTRIGGGNVTLLNQPNISVANSSTYENLFLNSIDGVIT
PPGNLSAVLNATNATAFVAFAQQVNTTNSDGSNTSAVNSLEQENGFTLFVPDNDAFQAAQQTIGGFQNNQTALNA
LLGNHIINGTTLYTPDFQNATASGSGANYITAAGENLSVSSNSSGIFLQNQNGSVAQITRPDVLVSNGVFHVIDN
VLVETDSNPEAASSAVMSASSAATAQSSTDTLPIGGGATLTSAGATSTPALLRFHRAL*
Coding >AgabiH97|032780
ATGTTCTCTTCGGTTGCTTTCACCTTACTCACTGTCGCTCTCCCCACGGTGCTTGCTCAAAGCTCAGACTCTGGT
TATGTGCAGGGTCTTGTCAATGAGCTGAACGCAATAGGTTACTCCGGAGCTGCGAACGCGCTCAGTCGTGCCAAC
GGTACCAGTAGCGGCCAACAATTTCTGTCGCAGGTACAAGACGGCAATTATACCGTATTCGTGCCCAACAATGCG
GCTTTCGAGAATTTGCCCAGCAATGTCACGAGTGACGATGACCTCGTCGCGCAATATCTGGCTTATCACTTCGTC
TATGGTAGCTTCCAAAACACGTCCACTACCAACTCATCTAGTGGCGGTGGCGGTGGCACGACTTCCTCCGCTAGT
GCCAGCGAGTCCTCTTCCACTGCGTCATCCACAGAGGCTTTCGCCTGGTACCAGCGACGAGATGAAGTTTCGAAC
TCATCTGATGCTCTACTCAGTGGCATCTATCCCAATACTACTATTGGTCGCACCCTCCTCAACTCTTCCGATCTT
GTTCAACTGGAGGCCAACAAGTCTCAAGTTCTCGCCTGGACAAGAATCGGCGGCGGTAATGTGACTCTGCTCAAT
CAGCCGAACATTTCTGTTGCAAACTCGTCTACCTACGAGAACTTGTTCCTGAACTCAATTGACGGTGTCATTACC
CCACCTGGCAATCTTTCTGCTGTCCTCAATGCGACCAATGCCACTGCCTTCGTCGCCTTCGCCCAGCAAGTGAAC
ACGACCAATTCCGACGGAAGTAACACCTCGGCGGTCAACTCGCTGGAGCAGGAAAATGGGTTCACCCTTTTCGTT
CCCGATAATGACGCGTTCCAGGCGGCTCAGCAGACAATTGGTGGTTTCCAGAACAACCAGACCGCTCTAAATGCT
CTTCTGGGCAATCACATCATCAACGGCACTACTCTTTACACCCCTGATTTCCAAAACGCCACCGCGTCAGGAAGT
GGTGCCAATTACATCACGGCTGCTGGCGAGAACCTCTCTGTTTCGTCCAACTCCTCCGGTATATTCCTTCAGAAT
CAAAACGGTAGTGTTGCCCAGATCACTCGGCCTGATGTTCTCGTCTCAAATGGCGTTTTCCACGTTATCGACAAC
GTCCTCGTGGAGACCGATTCCAATCCCGAAGCAGCCTCCTCTGCTGTGATGTCCGCCTCGTCTGCTGCAACCGCT
CAGAGTTCGACAGACACTCTTCCCATTGGCGGTGGCGCAACCCTCACTTCTGCGGGAGCTACTTCTACTCCTGCT
CTTCTTCGGTTCCATCGCGCTCTGTAA
Transcript >AgabiH97|032780
ATGTTCTCTTCGGTTGCTTTCACCTTACTCACTGTCGCTCTCCCCACGGTGCTTGCTCAAAGCTCAGACTCTGGT
TATGTGCAGGGTCTTGTCAATGAGCTGAACGCAATAGGTTACTCCGGAGCTGCGAACGCGCTCAGTCGTGCCAAC
GGTACCAGTAGCGGCCAACAATTTCTGTCGCAGGTACAAGACGGCAATTATACCGTATTCGTGCCCAACAATGCG
GCTTTCGAGAATTTGCCCAGCAATGTCACGAGTGACGATGACCTCGTCGCGCAATATCTGGCTTATCACTTCGTC
TATGGTAGCTTCCAAAACACGTCCACTACCAACTCATCTAGTGGCGGTGGCGGTGGCACGACTTCCTCCGCTAGT
GCCAGCGAGTCCTCTTCCACTGCGTCATCCACAGAGGCTTTCGCCTGGTACCAGCGACGAGATGAAGTTTCGAAC
TCATCTGATGCTCTACTCAGTGGCATCTATCCCAATACTACTATTGGTCGCACCCTCCTCAACTCTTCCGATCTT
GTTCAACTGGAGGCCAACAAGTCTCAAGTTCTCGCCTGGACAAGAATCGGCGGCGGTAATGTGACTCTGCTCAAT
CAGCCGAACATTTCTGTTGCAAACTCGTCTACCTACGAGAACTTGTTCCTGAACTCAATTGACGGTGTCATTACC
CCACCTGGCAATCTTTCTGCTGTCCTCAATGCGACCAATGCCACTGCCTTCGTCGCCTTCGCCCAGCAAGTGAAC
ACGACCAATTCCGACGGAAGTAACACCTCGGCGGTCAACTCGCTGGAGCAGGAAAATGGGTTCACCCTTTTCGTT
CCCGATAATGACGCGTTCCAGGCGGCTCAGCAGACAATTGGTGGTTTCCAGAACAACCAGACCGCTCTAAATGCT
CTTCTGGGCAATCACATCATCAACGGCACTACTCTTTACACCCCTGATTTCCAAAACGCCACCGCGTCAGGAAGT
GGTGCCAATTACATCACGGCTGCTGGCGAGAACCTCTCTGTTTCGTCCAACTCCTCCGGTATATTCCTTCAGAAT
CAAAACGGTAGTGTTGCCCAGATCACTCGGCCTGATGTTCTCGTCTCAAATGGCGTTTTCCACGTTATCGACAAC
GTCCTCGTGGAGACCGATTCCAATCCCGAAGCAGCCTCCTCTGCTGTGATGTCCGCCTCGTCTGCTGCAACCGCT
CAGAGTTCGACAGACACTCTTCCCATTGGCGGTGGCGCAACCCTCACTTCTGCGGGAGCTACTTCTACTCCTGCT
CTTCTTCGGTTCCATCGCGCTCTGTAA
Gene >AgabiH97|032780
ATGTTCTCTTCGGTTGCTTTCACCTTACTCACTGTCGCTCTCCCCACGGTGCTTGCTCAAAGCTCAGACTCTGGT
TATGTGCAGGGTCTTGTCAATGAGCTGAACGCAATAGGTTACTCCGGAGCTGCGAACGCGCTCAGTCGTGCCAAC
GGTACCAGTAGCGGCCAACAATTTCTGTCGCAGGTACAAGACGGCAATTATACCGTATTCGTGCCCAACAATGCG
GCTTGTGAGTTATCACTTTACTTTCCATTCGAAAATCTTGTCTGATTCCATTCCCTTTCAGTCGAGAATTTGCCC
AGCAATGTCACGAGTGACGATGACCTCGTCGCGCAATATCTGGCTTATCACTTCGTCTATGGTAGCTTCCAAAAC
ACGTCCACTACCAACTCATCTAGTGGCGGTGGCGGTGGCACGACTTCCTCCGCTAGTGCCAGCGAGTCCTCTTCC
ACTGCGTCATCCACAGAGGCTTTCGCCTGGTACCAGCGACGAGATGAAGTTTCGAACTCATCTGATGCTCTACTC
AGTGGCATCTATCCCAATACTACTATTGGTCGCACCCTCCTCAACTCTTCCGATCTTGTTCAACTGGAGGCCAAC
AAGTCTCAAGTTCTCGCCTGGACAAGAATCGGCGGCGGTAATGTGACTCTGCTCAATCAGCCGTAAGTCTTCGCC
TTAGCCTTAGGATGCTGAGTAATTTGACTGACATATCCTCTAGGAACATTTCTGTTGCAAACTCGTCTACCTACG
AGAACTTGTTCCTGAACTCAATTGACGGTGTCATTACCCCACCTGGCAATCTTTCTGCTGTCCTCAATGCGACCA
ATGCCACTGCCTTCGTCGCCTTCGCCCAGCAAGTGAACACGACCAATTCCGACGGAAGTAACACCTCGGCGGTCA
ACTCGCTGGAGCAGGAAAATGGGTTCACCCTTTTCGTTCCCGATAATGACGCGTTCCAGGCGGCTCAGCAGACAA
TTGGTGGTTTCCAGAACAACCAGACCGCTCTAAATGCTCTTCTGGGCAATCACGTATGACTTTGTTCAACACTGG
CACGTCAGTTTACAGGCTAACGACTTGATAGATCATCAACGGCACTACTCTTTACACCCCTGATTTCCAAAACGC
CACCGCGTCAGGAAGTGGTGCCAATTACATCACGGCTGCTGGCGAGAACCTCTCTGTTTCGTCCAACTCCTCCGG
TATATTCCTTCAGAATCAAAACGGTAGTGTTGCCCAGATCACTCGGCCTGATGTTCTCGTCTCAAATGGCGTTTT
CCACGTTATCGACAACGTCCTCGTGGAGACCGATTCCAATCCCGAAGCAGCCTCCTCTGCGTAAGTTTCCGTGAC
ACTCTCTTAATTCTTTATTAACCTTGATGATTTAGTGTGATGTCCGCCTCGTCTGCTGCAACCGCTCAGAGTTCG
ACAGACACTCTTCCCATTGGCGGTGGCGCAACCCTCACTTCTGCGGGAGCTACTTCTACTCCTGCTCTTCTTCGG
TTCCATCGCGCTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail