Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|032520
Gene name
Locationscaffold_12:1202837..1203665
Strand-
Gene length (bp)828
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.3E-06 30 75
PF01476 LysM LysM domain 1.5E-05 87 131

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|032520
MFSSKTIAVAVAAFFAQSALVAAADCSRTYTVKEGDICDSISSSQQSSTYQLAVSNQGAIDSSCSNLMPGQQICL
ATTAAEDCTDVYVVQPDDTCDGISSMKNLNSTILRLNNPQINEACDNIYVGEVMCVGSSVKVPPAPAGEIPATVI
PATAAPAVPTATKAPSHDNAAAPAPPAPTPAPQHEEEHDENEDEEDEDEEDLPFCDEI*
Coding >AgabiH97|032520
ATGTTCTCCTCAAAAACTATCGCTGTTGCTGTTGCTGCCTTCTTCGCCCAGTCCGCTCTCGTCGCCGCGGCTGAT
TGCTCCAGGACATACACTGTCAAGGAAGGAGATATCTGCGATAGCATCTCCTCCAGTCAACAAAGCTCGACTTAC
CAGCTTGCGGTTTCCAACCAAGGCGCCATCGACTCCTCCTGCAGCAACCTTATGCCTGGCCAGCAAATTTGTCTC
GCCACTACTGCAGCGGAAGACTGTACCGACGTCTACGTCGTGCAGCCAGACGACACGTGTGACGGCATTTCCTCC
ATGAAGAACCTCAACTCGACGATTCTCCGTCTCAACAACCCCCAAATTAACGAGGCATGCGATAATATCTATGTT
GGTGAGGTGATGTGTGTTGGCTCGTCAGTCAAGGTTCCTCCTGCCCCAGCAGGCGAAATCCCGGCGACCGTAATT
CCTGCAACTGCCGCTCCCGCTGTTCCCACAGCCACCAAAGCTCCCTCGCATGACAATGCCGCTGCCCCTGCACCC
CCTGCCCCTACCCCCGCCCCTCAACATGAGGAGGAGCATGATGAGAATGAAGATGAGGAGGACGAGGACGAGGAG
GACCTCCCATTCTGTGATGAGATCTAA
Transcript >AgabiH97|032520
ATGTTCTCCTCAAAAACTATCGCTGTTGCTGTTGCTGCCTTCTTCGCCCAGTCCGCTCTCGTCGCCGCGGCTGAT
TGCTCCAGGACATACACTGTCAAGGAAGGAGATATCTGCGATAGCATCTCCTCCAGTCAACAAAGCTCGACTTAC
CAGCTTGCGGTTTCCAACCAAGGCGCCATCGACTCCTCCTGCAGCAACCTTATGCCTGGCCAGCAAATTTGTCTC
GCCACTACTGCAGCGGAAGACTGTACCGACGTCTACGTCGTGCAGCCAGACGACACGTGTGACGGCATTTCCTCC
ATGAAGAACCTCAACTCGACGATTCTCCGTCTCAACAACCCCCAAATTAACGAGGCATGCGATAATATCTATGTT
GGTGAGGTGATGTGTGTTGGCTCGTCAGTCAAGGTTCCTCCTGCCCCAGCAGGCGAAATCCCGGCGACCGTAATT
CCTGCAACTGCCGCTCCCGCTGTTCCCACAGCCACCAAAGCTCCCTCGCATGACAATGCCGCTGCCCCTGCACCC
CCTGCCCCTACCCCCGCCCCTCAACATGAGGAGGAGCATGATGAGAATGAAGATGAGGAGGACGAGGACGAGGAG
GACCTCCCATTCTGTGATGAGATCTAA
Gene >AgabiH97|032520
ATGTTCTCCTCAAAAACTATCGCTGTTGCTGTTGCTGCCTTCTTCGCCCAGTGTAAGCATCTACCATCCACTCCA
CCGTGGAGCGCTCGGACCAAGCCCTGACTTGTTTTCTTTTTCCCTGTAGCCGCTCTCGTCGCCGCGGCTGATTGC
TCCAGGACATACACTGTCAAGGAAGGAGATATCTGCGATAGCATCTCCTCCAGTCAACAAAGCTCGACGTAAGTT
ACACCGCTTTGAGCAAGTTCAACACCTAAATCTTCTCGTAGTTACCAGCTTGCGGTTTCCAACCAAGGCGCCATC
GACTCCTCCTGCAGCAACCTTATGCCTGGCCAGCAAATTTGTCTCGCCACTACTGCAGCGGAAGACTGTACCGAC
GTCTACGTCGTGCAGCCAGACGACACGTGTGACGGCATTTCCTCCATGAAGAACCTCAACTCGACGATTCTCCGT
CTCAACAACCCCCAAATTAACGAGGCATGCGATAATATCTATGTTGGTGAGGTGAGTATAACACAGTGTGACCCT
GTGTGGCTATGTTTGAGATCAACAATCATTGACTGATACAATCTTTTTCTGCGACAGGTGATGTGTGTTGGCTCG
TCAGTCAAGGTTCCTCCTGCCCCAGCAGGCGAAATCCCGGCGACCGTAATTCCTGCAACTGCCGCTCCCGCTGTT
CCCACAGCCACCAAAGCTCCCTCGCATGACAATGCCGCTGCCCCTGCACCCCCTGCCCCTACCCCCGCCCCTCAA
CATGAGGAGGAGCATGATGAGAATGAAGATGAGGAGGACGAGGACGAGGAGGACCTCCCATTCTGTGATGAGATC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail