Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|032400
Gene name
Locationscaffold_12:1174379..1178816
Strand+
Gene length (bp)4437
Transcript length (bp)4437
Coding sequence length (bp)4437
Protein length (aa) 1479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 5.7E-49 984 1225
PF13976 gag_pre-integrs GAG-pre-integrase domain 7.7E-13 512 585
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 4.6E-09 102 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 130 1451 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 969 1470 3.0E-89
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 364 829 5.0E-48
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1064 1365 1.0E-35
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1148 1377 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 130 1451 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 969 1470 3.0E-89
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 364 829 5.0E-48
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1064 1365 1.0E-35
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1148 1377 1.0E-31
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 350 774 1.0E-26
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 401 774 2.0E-26
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 401 774 2.0E-26
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 401 774 2.0E-26
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 401 774 2.0E-26
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 401 774 2.0E-26
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 401 774 2.0E-26
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 401 774 2.0E-26
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 401 774 2.0E-26
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 259 774 2.0E-26
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 401 774 2.0E-26
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 401 774 2.0E-26
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 401 774 2.0E-26
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 401 774 2.0E-26
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 401 774 2.0E-26
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 401 774 3.0E-26
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 401 774 3.0E-26
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 401 774 3.0E-26
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 401 774 3.0E-26
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 401 774 3.0E-26
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 401 774 3.0E-26
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 401 774 3.0E-26
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 401 774 3.0E-26
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 401 774 3.0E-26
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 401 774 3.0E-26
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 401 774 4.0E-26
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 401 774 4.0E-26
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 401 774 4.0E-26
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 401 774 4.0E-26
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 401 774 5.0E-26
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 401 774 5.0E-26
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 401 774 2.0E-25
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 393 774 6.0E-23
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 393 774 6.0E-23
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 393 774 6.0E-23
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 393 774 6.0E-23
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 393 774 6.0E-23
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 393 774 6.0E-23
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 393 774 7.0E-23
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 393 774 7.0E-23
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 393 774 7.0E-23
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 393 774 7.0E-23
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 393 774 7.0E-23
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 393 774 8.0E-23
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 963 1454 4.0E-21
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 963 1454 5.0E-21
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 573 774 6.0E-18
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 433 790 1.0E-17
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 433 790 2.0E-17
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 433 790 3.0E-17
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 995 1453 2.0E-16
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 995 1453 2.0E-16
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 995 1453 7.0E-16
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 995 1453 7.0E-16
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 995 1453 1.0E-15
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 995 1453 1.0E-15
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 995 1453 1.0E-15
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 995 1453 2.0E-15
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 995 1453 2.0E-15
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 995 1453 2.0E-15
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 995 1453 2.0E-15
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 995 1453 2.0E-15
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 995 1453 2.0E-15
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 995 1453 2.0E-15
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 995 1453 2.0E-15
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 995 1453 2.0E-15
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 995 1453 3.0E-15
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 995 1453 3.0E-15
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 995 1453 3.0E-15
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 995 1453 3.0E-15
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 995 1453 4.0E-15
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 995 1453 4.0E-15
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 995 1453 4.0E-15
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 995 1453 4.0E-15
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 995 1453 4.0E-15
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 995 1453 4.0E-15
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 995 1453 5.0E-15
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 995 1453 5.0E-15
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 995 1453 5.0E-15
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 995 1453 5.0E-15
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 995 1453 5.0E-15
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 995 1453 5.0E-15
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 995 1453 6.0E-15
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 995 1453 8.0E-15
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 995 1453 8.0E-15
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 995 1453 1.0E-14
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 995 1453 3.0E-14
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 995 1453 3.0E-14
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 995 1453 3.0E-14
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 995 1453 3.0E-14
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 995 1453 3.0E-14
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 995 1453 4.0E-14
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 995 1453 2.0E-13
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 956 1057 1.0E-12
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 712 780 7.0E-10
sp|P93293|M300_ARATH Uncharacterized mitochondrial protein AtMg00300 OS=Arabidopsis thaliana GN=AtMg00300 PE=4 SV=1 474 614 4.0E-08
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1259 1341 2.0E-07
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 598 755 3.0E-07
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 575 744 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|032400
MSGTGGSAPPIFADGSKFNGSNWVNWRGLIQIAADLRGVRGYLDGTVTQPPQPSLNTLNAPIPPPPNDDAADTPP
TPPIITQTTTTTPDSPWESTIPTPTEWRVRNAWAMGLLIYNTNDPVGLGINISGTAADAWKSYVDTYQVASEVAI
INAELDLRNVSYVDGQDFVEFISRMRTKWSNATALGATIDDKAFRMIILSALPRSWDSIVATLYTTQSSRDAINQ
LMTHWARISRDRPTNPQSSTSALQASTPSRGRQRNQHLHCTNQNCNRRGHTIEDCYWPGGGKAGQFPPGFGRRGG
AKNTPTTDQATNQNTTANVTTTSGPSPNNDTEPKVFALATTVVDEQEVPSNPPSSPDSDPIATRITSNITSEGSN
QTEGAVDGYHTELLNIPDSHNNIPTLLDSGASDHCFVQRHRFSQYQSFVPPRTGNTAGKGSTFNIEGSGTIEFLT
NVNGVASKIVMVDCLHTPQLRSSLISVSKLVSRGSTVSFEGSSAVVRDVAGNNVLTAIKRNGLYVVDTADVPNAH
ANAAQTKRKPVPYDIWHRRLGHIPTDVISKMVRENLVDGLNTSGEPKLDGLCEDCIYGKHTTHPFSDTAPNETEP
LERIYVDIWGPSPVESAGGAKYFMLLVDGATSYRKVYFLPSKSADETLKVFKEYHLESERQTGKKLKRVRLDMGR
EWHNSTWDQYVKSSGILLDFTTPYAHQQNGRAERSMRTLLDTARTLLADAGLPQKYWADAVQTAAYTCNLIPTTR
SPSHIPAQMWLQKRQDVSHLRPFGSTAYAHVPSEISPSKLSARSLKLTLIGYFERSGYKLLDRSTGAIHKSRDVI
FEESRPHLSTDPIVAFRPDDSAPVTRDPAAIAPRPKPISTLHPPAPPLPSTVQPTKPLATSKDDSDSDGKQDSEG
EVTHLLRDPDDDSIAARRPRREVKLSSKMKESLEYLGRTRANVADTNIVDEDTYVPKNFYDAMKKPELWFPPMMK
ELEVMREKQVYRLVPRPPDKNVVKSRWVYANKYDESGLITARKARLVAKGFTQVLGEDYNETYASVARLESVRMV
CALAASLGLRLWQVDFVSAFLNSENTFEVYMEQPPGFEEGGDTVWLLLKTLYGTMQGAHDWARTLESTYQSHGYT
TSRADPQIRFRLQDGELSLTSTWTDDILGASSTEMGEIRAKGELKSSYELKDLGAARYILGMKIEKDDTTGSIRL
SQRAYAERVLERFHMADANVRSTPLPAGVVLSVDDSPHSAEETLEMKDVPYREALGSLMWLQVATRPDLSFAVNL
LSRFANNPGHAHWEALKHTLAYLRGTLDYGITYYRNASIRPFGYVDADHAGDKDTSRSTEGHIFFVAGGAVSWTS
KRQERVSLSTVEAEYTAFTHVTQQAIWLTKFLDELGMGQERPVMIFADNNGAMANTTNNKNHRRTKHIRVKHHFT
KESVALGEVGFTYIPSADNLADIFTKPLAKEAVLFICGGIGLIKDTSPKQGEC*
Coding >AgabiH97|032400
ATGTCTGGCACTGGCGGCAGTGCACCACCGATCTTCGCTGACGGATCGAAGTTCAATGGATCTAATTGGGTCAAT
TGGAGAGGCCTCATACAAATTGCGGCTGACTTACGAGGTGTACGAGGGTATCTTGATGGTACTGTCACCCAACCT
CCTCAGCCATCCCTTAACACATTAAACGCGCCTATACCTCCACCACCTAACGATGACGCTGCTGATACACCACCT
ACACCACCAATTATCACGCAGACGACTACCACCACTCCTGATTCGCCTTGGGAATCGACTATACCCACCCCGACT
GAATGGAGAGTCCGTAACGCGTGGGCTATGGGGTTGCTGATTTACAACACAAACGATCCGGTTGGCCTTGGCATT
AACATAAGCGGAACGGCCGCTGATGCTTGGAAATCATACGTTGACACCTATCAAGTTGCGTCAGAGGTCGCTATC
ATAAATGCTGAGCTTGACCTCCGCAATGTGTCTTACGTTGATGGACAAGACTTTGTTGAGTTTATCTCTCGCATG
CGTACGAAATGGTCGAATGCAACAGCTCTAGGAGCGACCATAGACGATAAAGCTTTCCGCATGATTATCCTCAGC
GCTCTTCCACGATCATGGGACTCTATTGTCGCGACGTTATACACTACCCAATCTTCACGAGATGCCATTAATCAG
TTAATGACCCATTGGGCTAGAATAAGTAGAGATAGACCTACCAATCCCCAGTCATCGACATCTGCCCTCCAAGCA
TCCACACCCAGCCGTGGTCGTCAGCGTAACCAACATCTTCACTGCACCAATCAGAATTGCAACCGTCGTGGCCAC
ACCATTGAAGATTGTTACTGGCCTGGAGGAGGGAAAGCCGGTCAGTTTCCTCCTGGGTTTGGCAGACGCGGGGGA
GCGAAAAACACACCTACTACGGATCAGGCTACCAACCAAAACACTACCGCCAACGTCACTACGACCAGTGGACCT
AGCCCTAACAATGATACTGAACCCAAGGTCTTCGCCCTCGCGACCACAGTGGTTGATGAGCAAGAGGTACCCTCC
AACCCTCCATCATCCCCAGATTCTGATCCTATCGCTACCAGAATTACGTCCAATATCACATCTGAAGGATCGAAT
CAGACTGAGGGAGCTGTGGATGGGTATCATACCGAATTGTTAAACATACCTGACTCTCACAATAACATCCCCACT
CTGTTGGATTCGGGTGCGAGTGATCATTGTTTCGTCCAGCGACACCGTTTCTCTCAATATCAGTCATTTGTTCCA
CCGAGAACGGGAAATACTGCCGGCAAAGGGTCAACCTTCAATATTGAAGGTTCTGGCACAATAGAATTCTTGACA
AACGTGAACGGTGTCGCATCAAAGATCGTGATGGTCGATTGTCTTCATACGCCGCAATTACGCTCGAGTTTGATA
TCTGTCTCTAAATTGGTTTCGAGGGGATCGACCGTTAGCTTTGAAGGGAGCTCAGCAGTTGTGCGCGACGTGGCA
GGGAACAACGTACTCACCGCTATCAAAAGGAATGGTTTATACGTGGTTGATACGGCTGATGTACCCAATGCACAT
GCGAACGCGGCCCAGACCAAGCGCAAGCCAGTACCGTATGATATCTGGCATAGACGCCTCGGACATATTCCTACG
GATGTCATCTCGAAGATGGTGCGAGAGAACCTAGTTGACGGCCTGAATACGAGTGGCGAACCTAAGCTGGATGGG
TTATGTGAGGACTGCATCTATGGGAAGCATACGACTCACCCATTCAGCGATACCGCTCCGAATGAGACAGAACCT
CTAGAACGCATATACGTGGACATTTGGGGACCCTCACCGGTGGAGTCTGCTGGGGGAGCGAAATACTTCATGCTC
TTGGTAGACGGCGCCACTTCATACAGGAAGGTCTATTTCCTACCCTCGAAGTCTGCGGACGAGACCCTGAAGGTC
TTCAAGGAATATCATCTGGAGAGTGAACGGCAAACTGGGAAGAAATTGAAGAGAGTGCGTTTGGACATGGGGAGA
GAGTGGCACAACTCGACGTGGGATCAATACGTAAAGTCGAGCGGCATTCTTCTCGACTTTACCACACCCTATGCA
CATCAACAAAACGGTAGAGCTGAGCGCTCCATGCGCACCTTGCTCGATACCGCCCGCACACTGTTGGCCGACGCT
GGGCTGCCACAGAAATACTGGGCTGATGCTGTCCAAACGGCGGCCTATACCTGCAACCTCATCCCCACCACCCGC
TCCCCGAGTCATATTCCTGCTCAAATGTGGCTACAGAAGAGACAGGATGTGTCCCACCTTCGTCCTTTTGGATCT
ACAGCTTATGCCCACGTCCCCTCTGAGATAAGCCCTTCCAAGCTGTCCGCACGTTCACTCAAGCTCACACTTATT
GGCTACTTTGAACGGTCTGGCTATAAGCTACTTGACCGTTCTACCGGCGCTATACACAAATCCAGAGACGTCATA
TTTGAAGAGTCTCGTCCCCACCTCTCAACCGACCCGATTGTGGCGTTCCGGCCTGACGACTCGGCGCCGGTCACT
CGAGATCCTGCTGCTATTGCACCACGACCCAAACCTATCTCGACGCTCCATCCGCCTGCCCCGCCGCTTCCTTCT
ACAGTTCAACCAACAAAGCCTTTGGCAACTTCGAAGGATGACTCCGATTCCGATGGCAAGCAGGACAGTGAAGGG
GAGGTTACACACCTTCTCCGTGATCCTGACGATGATTCAATAGCGGCGAGGAGACCTAGACGGGAGGTGAAGCTG
AGCTCGAAGATGAAGGAGAGCTTGGAGTATTTGGGACGAACTAGAGCGAACGTTGCCGACACCAACATTGTCGAC
GAAGACACATACGTGCCGAAGAACTTCTATGACGCCATGAAGAAACCTGAGCTATGGTTTCCGCCTATGATGAAG
GAGTTGGAAGTGATGAGAGAGAAACAGGTTTATCGTTTGGTACCACGTCCTCCCGACAAGAATGTTGTGAAGTCC
CGCTGGGTCTATGCGAACAAATATGATGAGTCTGGACTCATTACGGCGCGCAAGGCTCGCCTGGTTGCCAAGGGG
TTCACGCAGGTGCTGGGGGAAGATTATAATGAGACGTACGCCTCTGTGGCACGCCTGGAGTCCGTACGTATGGTT
TGTGCGCTAGCTGCCTCCCTCGGCCTTCGTCTCTGGCAGGTTGATTTCGTGTCAGCTTTCTTGAACAGCGAGAAC
ACGTTTGAGGTGTATATGGAGCAGCCGCCAGGTTTTGAGGAGGGGGGAGATACCGTGTGGTTACTTCTCAAAACG
CTGTATGGAACAATGCAAGGAGCGCACGACTGGGCACGCACACTCGAGAGTACCTACCAGAGCCATGGATACACT
ACTTCCAGAGCCGACCCACAAATACGATTTCGACTACAAGATGGTGAACTGTCATTAACATCGACATGGACTGAT
GATATTCTCGGGGCATCTTCGACAGAAATGGGGGAGATCAGAGCCAAGGGGGAGTTGAAGAGCAGCTACGAGTTA
AAGGACCTGGGGGCGGCGAGATACATTCTTGGGATGAAGATAGAGAAGGACGACACTACAGGGAGCATCAGATTA
TCCCAACGCGCTTACGCTGAAAGAGTCCTTGAACGGTTTCATATGGCTGATGCCAATGTTCGGTCGACACCTTTG
CCCGCTGGAGTCGTACTTTCAGTTGACGACTCTCCACATTCTGCTGAAGAAACCCTAGAGATGAAGGACGTACCG
TACCGTGAGGCCTTGGGCTCTCTCATGTGGCTCCAAGTGGCTACCCGACCTGACCTGTCTTTCGCCGTGAACTTG
TTATCTAGATTCGCCAACAACCCCGGCCATGCTCACTGGGAAGCCCTTAAGCATACTCTGGCTTATCTTCGGGGA
ACACTCGACTATGGCATAACCTATTACAGAAATGCCAGTATCCGGCCTTTTGGATATGTCGACGCAGACCACGCT
GGCGACAAGGACACTTCCAGGTCAACTGAAGGTCATATTTTCTTCGTCGCTGGCGGCGCGGTATCTTGGACGAGC
AAACGGCAGGAACGAGTGTCTCTTTCTACAGTTGAAGCTGAATATACTGCCTTCACTCATGTTACGCAACAAGCC
ATCTGGCTGACCAAATTCTTGGACGAGCTAGGCATGGGACAGGAACGGCCAGTGATGATCTTTGCGGATAACAAC
GGCGCAATGGCTAACACTACCAATAACAAGAACCACCGTCGTACAAAACATATCCGCGTCAAACATCACTTTACC
AAAGAGAGCGTTGCACTTGGCGAGGTCGGCTTCACATACATTCCTTCAGCAGACAACTTAGCCGACATCTTTACA
AAACCACTCGCTAAAGAAGCCGTGCTATTCATTTGTGGTGGTATTGGGCTTATCAAGGACACGTCGCCGAAGCAG
GGGGAGTGTTGA
Transcript >AgabiH97|032400
ATGTCTGGCACTGGCGGCAGTGCACCACCGATCTTCGCTGACGGATCGAAGTTCAATGGATCTAATTGGGTCAAT
TGGAGAGGCCTCATACAAATTGCGGCTGACTTACGAGGTGTACGAGGGTATCTTGATGGTACTGTCACCCAACCT
CCTCAGCCATCCCTTAACACATTAAACGCGCCTATACCTCCACCACCTAACGATGACGCTGCTGATACACCACCT
ACACCACCAATTATCACGCAGACGACTACCACCACTCCTGATTCGCCTTGGGAATCGACTATACCCACCCCGACT
GAATGGAGAGTCCGTAACGCGTGGGCTATGGGGTTGCTGATTTACAACACAAACGATCCGGTTGGCCTTGGCATT
AACATAAGCGGAACGGCCGCTGATGCTTGGAAATCATACGTTGACACCTATCAAGTTGCGTCAGAGGTCGCTATC
ATAAATGCTGAGCTTGACCTCCGCAATGTGTCTTACGTTGATGGACAAGACTTTGTTGAGTTTATCTCTCGCATG
CGTACGAAATGGTCGAATGCAACAGCTCTAGGAGCGACCATAGACGATAAAGCTTTCCGCATGATTATCCTCAGC
GCTCTTCCACGATCATGGGACTCTATTGTCGCGACGTTATACACTACCCAATCTTCACGAGATGCCATTAATCAG
TTAATGACCCATTGGGCTAGAATAAGTAGAGATAGACCTACCAATCCCCAGTCATCGACATCTGCCCTCCAAGCA
TCCACACCCAGCCGTGGTCGTCAGCGTAACCAACATCTTCACTGCACCAATCAGAATTGCAACCGTCGTGGCCAC
ACCATTGAAGATTGTTACTGGCCTGGAGGAGGGAAAGCCGGTCAGTTTCCTCCTGGGTTTGGCAGACGCGGGGGA
GCGAAAAACACACCTACTACGGATCAGGCTACCAACCAAAACACTACCGCCAACGTCACTACGACCAGTGGACCT
AGCCCTAACAATGATACTGAACCCAAGGTCTTCGCCCTCGCGACCACAGTGGTTGATGAGCAAGAGGTACCCTCC
AACCCTCCATCATCCCCAGATTCTGATCCTATCGCTACCAGAATTACGTCCAATATCACATCTGAAGGATCGAAT
CAGACTGAGGGAGCTGTGGATGGGTATCATACCGAATTGTTAAACATACCTGACTCTCACAATAACATCCCCACT
CTGTTGGATTCGGGTGCGAGTGATCATTGTTTCGTCCAGCGACACCGTTTCTCTCAATATCAGTCATTTGTTCCA
CCGAGAACGGGAAATACTGCCGGCAAAGGGTCAACCTTCAATATTGAAGGTTCTGGCACAATAGAATTCTTGACA
AACGTGAACGGTGTCGCATCAAAGATCGTGATGGTCGATTGTCTTCATACGCCGCAATTACGCTCGAGTTTGATA
TCTGTCTCTAAATTGGTTTCGAGGGGATCGACCGTTAGCTTTGAAGGGAGCTCAGCAGTTGTGCGCGACGTGGCA
GGGAACAACGTACTCACCGCTATCAAAAGGAATGGTTTATACGTGGTTGATACGGCTGATGTACCCAATGCACAT
GCGAACGCGGCCCAGACCAAGCGCAAGCCAGTACCGTATGATATCTGGCATAGACGCCTCGGACATATTCCTACG
GATGTCATCTCGAAGATGGTGCGAGAGAACCTAGTTGACGGCCTGAATACGAGTGGCGAACCTAAGCTGGATGGG
TTATGTGAGGACTGCATCTATGGGAAGCATACGACTCACCCATTCAGCGATACCGCTCCGAATGAGACAGAACCT
CTAGAACGCATATACGTGGACATTTGGGGACCCTCACCGGTGGAGTCTGCTGGGGGAGCGAAATACTTCATGCTC
TTGGTAGACGGCGCCACTTCATACAGGAAGGTCTATTTCCTACCCTCGAAGTCTGCGGACGAGACCCTGAAGGTC
TTCAAGGAATATCATCTGGAGAGTGAACGGCAAACTGGGAAGAAATTGAAGAGAGTGCGTTTGGACATGGGGAGA
GAGTGGCACAACTCGACGTGGGATCAATACGTAAAGTCGAGCGGCATTCTTCTCGACTTTACCACACCCTATGCA
CATCAACAAAACGGTAGAGCTGAGCGCTCCATGCGCACCTTGCTCGATACCGCCCGCACACTGTTGGCCGACGCT
GGGCTGCCACAGAAATACTGGGCTGATGCTGTCCAAACGGCGGCCTATACCTGCAACCTCATCCCCACCACCCGC
TCCCCGAGTCATATTCCTGCTCAAATGTGGCTACAGAAGAGACAGGATGTGTCCCACCTTCGTCCTTTTGGATCT
ACAGCTTATGCCCACGTCCCCTCTGAGATAAGCCCTTCCAAGCTGTCCGCACGTTCACTCAAGCTCACACTTATT
GGCTACTTTGAACGGTCTGGCTATAAGCTACTTGACCGTTCTACCGGCGCTATACACAAATCCAGAGACGTCATA
TTTGAAGAGTCTCGTCCCCACCTCTCAACCGACCCGATTGTGGCGTTCCGGCCTGACGACTCGGCGCCGGTCACT
CGAGATCCTGCTGCTATTGCACCACGACCCAAACCTATCTCGACGCTCCATCCGCCTGCCCCGCCGCTTCCTTCT
ACAGTTCAACCAACAAAGCCTTTGGCAACTTCGAAGGATGACTCCGATTCCGATGGCAAGCAGGACAGTGAAGGG
GAGGTTACACACCTTCTCCGTGATCCTGACGATGATTCAATAGCGGCGAGGAGACCTAGACGGGAGGTGAAGCTG
AGCTCGAAGATGAAGGAGAGCTTGGAGTATTTGGGACGAACTAGAGCGAACGTTGCCGACACCAACATTGTCGAC
GAAGACACATACGTGCCGAAGAACTTCTATGACGCCATGAAGAAACCTGAGCTATGGTTTCCGCCTATGATGAAG
GAGTTGGAAGTGATGAGAGAGAAACAGGTTTATCGTTTGGTACCACGTCCTCCCGACAAGAATGTTGTGAAGTCC
CGCTGGGTCTATGCGAACAAATATGATGAGTCTGGACTCATTACGGCGCGCAAGGCTCGCCTGGTTGCCAAGGGG
TTCACGCAGGTGCTGGGGGAAGATTATAATGAGACGTACGCCTCTGTGGCACGCCTGGAGTCCGTACGTATGGTT
TGTGCGCTAGCTGCCTCCCTCGGCCTTCGTCTCTGGCAGGTTGATTTCGTGTCAGCTTTCTTGAACAGCGAGAAC
ACGTTTGAGGTGTATATGGAGCAGCCGCCAGGTTTTGAGGAGGGGGGAGATACCGTGTGGTTACTTCTCAAAACG
CTGTATGGAACAATGCAAGGAGCGCACGACTGGGCACGCACACTCGAGAGTACCTACCAGAGCCATGGATACACT
ACTTCCAGAGCCGACCCACAAATACGATTTCGACTACAAGATGGTGAACTGTCATTAACATCGACATGGACTGAT
GATATTCTCGGGGCATCTTCGACAGAAATGGGGGAGATCAGAGCCAAGGGGGAGTTGAAGAGCAGCTACGAGTTA
AAGGACCTGGGGGCGGCGAGATACATTCTTGGGATGAAGATAGAGAAGGACGACACTACAGGGAGCATCAGATTA
TCCCAACGCGCTTACGCTGAAAGAGTCCTTGAACGGTTTCATATGGCTGATGCCAATGTTCGGTCGACACCTTTG
CCCGCTGGAGTCGTACTTTCAGTTGACGACTCTCCACATTCTGCTGAAGAAACCCTAGAGATGAAGGACGTACCG
TACCGTGAGGCCTTGGGCTCTCTCATGTGGCTCCAAGTGGCTACCCGACCTGACCTGTCTTTCGCCGTGAACTTG
TTATCTAGATTCGCCAACAACCCCGGCCATGCTCACTGGGAAGCCCTTAAGCATACTCTGGCTTATCTTCGGGGA
ACACTCGACTATGGCATAACCTATTACAGAAATGCCAGTATCCGGCCTTTTGGATATGTCGACGCAGACCACGCT
GGCGACAAGGACACTTCCAGGTCAACTGAAGGTCATATTTTCTTCGTCGCTGGCGGCGCGGTATCTTGGACGAGC
AAACGGCAGGAACGAGTGTCTCTTTCTACAGTTGAAGCTGAATATACTGCCTTCACTCATGTTACGCAACAAGCC
ATCTGGCTGACCAAATTCTTGGACGAGCTAGGCATGGGACAGGAACGGCCAGTGATGATCTTTGCGGATAACAAC
GGCGCAATGGCTAACACTACCAATAACAAGAACCACCGTCGTACAAAACATATCCGCGTCAAACATCACTTTACC
AAAGAGAGCGTTGCACTTGGCGAGGTCGGCTTCACATACATTCCTTCAGCAGACAACTTAGCCGACATCTTTACA
AAACCACTCGCTAAAGAAGCCGTGCTATTCATTTGTGGTGGTATTGGGCTTATCAAGGACACGTCGCCGAAGCAG
GGGGAGTGTTGA
Gene >AgabiH97|032400
ATGTCTGGCACTGGCGGCAGTGCACCACCGATCTTCGCTGACGGATCGAAGTTCAATGGATCTAATTGGGTCAAT
TGGAGAGGCCTCATACAAATTGCGGCTGACTTACGAGGTGTACGAGGGTATCTTGATGGTACTGTCACCCAACCT
CCTCAGCCATCCCTTAACACATTAAACGCGCCTATACCTCCACCACCTAACGATGACGCTGCTGATACACCACCT
ACACCACCAATTATCACGCAGACGACTACCACCACTCCTGATTCGCCTTGGGAATCGACTATACCCACCCCGACT
GAATGGAGAGTCCGTAACGCGTGGGCTATGGGGTTGCTGATTTACAACACAAACGATCCGGTTGGCCTTGGCATT
AACATAAGCGGAACGGCCGCTGATGCTTGGAAATCATACGTTGACACCTATCAAGTTGCGTCAGAGGTCGCTATC
ATAAATGCTGAGCTTGACCTCCGCAATGTGTCTTACGTTGATGGACAAGACTTTGTTGAGTTTATCTCTCGCATG
CGTACGAAATGGTCGAATGCAACAGCTCTAGGAGCGACCATAGACGATAAAGCTTTCCGCATGATTATCCTCAGC
GCTCTTCCACGATCATGGGACTCTATTGTCGCGACGTTATACACTACCCAATCTTCACGAGATGCCATTAATCAG
TTAATGACCCATTGGGCTAGAATAAGTAGAGATAGACCTACCAATCCCCAGTCATCGACATCTGCCCTCCAAGCA
TCCACACCCAGCCGTGGTCGTCAGCGTAACCAACATCTTCACTGCACCAATCAGAATTGCAACCGTCGTGGCCAC
ACCATTGAAGATTGTTACTGGCCTGGAGGAGGGAAAGCCGGTCAGTTTCCTCCTGGGTTTGGCAGACGCGGGGGA
GCGAAAAACACACCTACTACGGATCAGGCTACCAACCAAAACACTACCGCCAACGTCACTACGACCAGTGGACCT
AGCCCTAACAATGATACTGAACCCAAGGTCTTCGCCCTCGCGACCACAGTGGTTGATGAGCAAGAGGTACCCTCC
AACCCTCCATCATCCCCAGATTCTGATCCTATCGCTACCAGAATTACGTCCAATATCACATCTGAAGGATCGAAT
CAGACTGAGGGAGCTGTGGATGGGTATCATACCGAATTGTTAAACATACCTGACTCTCACAATAACATCCCCACT
CTGTTGGATTCGGGTGCGAGTGATCATTGTTTCGTCCAGCGACACCGTTTCTCTCAATATCAGTCATTTGTTCCA
CCGAGAACGGGAAATACTGCCGGCAAAGGGTCAACCTTCAATATTGAAGGTTCTGGCACAATAGAATTCTTGACA
AACGTGAACGGTGTCGCATCAAAGATCGTGATGGTCGATTGTCTTCATACGCCGCAATTACGCTCGAGTTTGATA
TCTGTCTCTAAATTGGTTTCGAGGGGATCGACCGTTAGCTTTGAAGGGAGCTCAGCAGTTGTGCGCGACGTGGCA
GGGAACAACGTACTCACCGCTATCAAAAGGAATGGTTTATACGTGGTTGATACGGCTGATGTACCCAATGCACAT
GCGAACGCGGCCCAGACCAAGCGCAAGCCAGTACCGTATGATATCTGGCATAGACGCCTCGGACATATTCCTACG
GATGTCATCTCGAAGATGGTGCGAGAGAACCTAGTTGACGGCCTGAATACGAGTGGCGAACCTAAGCTGGATGGG
TTATGTGAGGACTGCATCTATGGGAAGCATACGACTCACCCATTCAGCGATACCGCTCCGAATGAGACAGAACCT
CTAGAACGCATATACGTGGACATTTGGGGACCCTCACCGGTGGAGTCTGCTGGGGGAGCGAAATACTTCATGCTC
TTGGTAGACGGCGCCACTTCATACAGGAAGGTCTATTTCCTACCCTCGAAGTCTGCGGACGAGACCCTGAAGGTC
TTCAAGGAATATCATCTGGAGAGTGAACGGCAAACTGGGAAGAAATTGAAGAGAGTGCGTTTGGACATGGGGAGA
GAGTGGCACAACTCGACGTGGGATCAATACGTAAAGTCGAGCGGCATTCTTCTCGACTTTACCACACCCTATGCA
CATCAACAAAACGGTAGAGCTGAGCGCTCCATGCGCACCTTGCTCGATACCGCCCGCACACTGTTGGCCGACGCT
GGGCTGCCACAGAAATACTGGGCTGATGCTGTCCAAACGGCGGCCTATACCTGCAACCTCATCCCCACCACCCGC
TCCCCGAGTCATATTCCTGCTCAAATGTGGCTACAGAAGAGACAGGATGTGTCCCACCTTCGTCCTTTTGGATCT
ACAGCTTATGCCCACGTCCCCTCTGAGATAAGCCCTTCCAAGCTGTCCGCACGTTCACTCAAGCTCACACTTATT
GGCTACTTTGAACGGTCTGGCTATAAGCTACTTGACCGTTCTACCGGCGCTATACACAAATCCAGAGACGTCATA
TTTGAAGAGTCTCGTCCCCACCTCTCAACCGACCCGATTGTGGCGTTCCGGCCTGACGACTCGGCGCCGGTCACT
CGAGATCCTGCTGCTATTGCACCACGACCCAAACCTATCTCGACGCTCCATCCGCCTGCCCCGCCGCTTCCTTCT
ACAGTTCAACCAACAAAGCCTTTGGCAACTTCGAAGGATGACTCCGATTCCGATGGCAAGCAGGACAGTGAAGGG
GAGGTTACACACCTTCTCCGTGATCCTGACGATGATTCAATAGCGGCGAGGAGACCTAGACGGGAGGTGAAGCTG
AGCTCGAAGATGAAGGAGAGCTTGGAGTATTTGGGACGAACTAGAGCGAACGTTGCCGACACCAACATTGTCGAC
GAAGACACATACGTGCCGAAGAACTTCTATGACGCCATGAAGAAACCTGAGCTATGGTTTCCGCCTATGATGAAG
GAGTTGGAAGTGATGAGAGAGAAACAGGTTTATCGTTTGGTACCACGTCCTCCCGACAAGAATGTTGTGAAGTCC
CGCTGGGTCTATGCGAACAAATATGATGAGTCTGGACTCATTACGGCGCGCAAGGCTCGCCTGGTTGCCAAGGGG
TTCACGCAGGTGCTGGGGGAAGATTATAATGAGACGTACGCCTCTGTGGCACGCCTGGAGTCCGTACGTATGGTT
TGTGCGCTAGCTGCCTCCCTCGGCCTTCGTCTCTGGCAGGTTGATTTCGTGTCAGCTTTCTTGAACAGCGAGAAC
ACGTTTGAGGTGTATATGGAGCAGCCGCCAGGTTTTGAGGAGGGGGGAGATACCGTGTGGTTACTTCTCAAAACG
CTGTATGGAACAATGCAAGGAGCGCACGACTGGGCACGCACACTCGAGAGTACCTACCAGAGCCATGGATACACT
ACTTCCAGAGCCGACCCACAAATACGATTTCGACTACAAGATGGTGAACTGTCATTAACATCGACATGGACTGAT
GATATTCTCGGGGCATCTTCGACAGAAATGGGGGAGATCAGAGCCAAGGGGGAGTTGAAGAGCAGCTACGAGTTA
AAGGACCTGGGGGCGGCGAGATACATTCTTGGGATGAAGATAGAGAAGGACGACACTACAGGGAGCATCAGATTA
TCCCAACGCGCTTACGCTGAAAGAGTCCTTGAACGGTTTCATATGGCTGATGCCAATGTTCGGTCGACACCTTTG
CCCGCTGGAGTCGTACTTTCAGTTGACGACTCTCCACATTCTGCTGAAGAAACCCTAGAGATGAAGGACGTACCG
TACCGTGAGGCCTTGGGCTCTCTCATGTGGCTCCAAGTGGCTACCCGACCTGACCTGTCTTTCGCCGTGAACTTG
TTATCTAGATTCGCCAACAACCCCGGCCATGCTCACTGGGAAGCCCTTAAGCATACTCTGGCTTATCTTCGGGGA
ACACTCGACTATGGCATAACCTATTACAGAAATGCCAGTATCCGGCCTTTTGGATATGTCGACGCAGACCACGCT
GGCGACAAGGACACTTCCAGGTCAACTGAAGGTCATATTTTCTTCGTCGCTGGCGGCGCGGTATCTTGGACGAGC
AAACGGCAGGAACGAGTGTCTCTTTCTACAGTTGAAGCTGAATATACTGCCTTCACTCATGTTACGCAACAAGCC
ATCTGGCTGACCAAATTCTTGGACGAGCTAGGCATGGGACAGGAACGGCCAGTGATGATCTTTGCGGATAACAAC
GGCGCAATGGCTAACACTACCAATAACAAGAACCACCGTCGTACAAAACATATCCGCGTCAAACATCACTTTACC
AAAGAGAGCGTTGCACTTGGCGAGGTCGGCTTCACATACATTCCTTCAGCAGACAACTTAGCCGACATCTTTACA
AAACCACTCGCTAAAGAAGCCGTGCTATTCATTTGTGGTGGTATTGGGCTTATCAAGGACACGTCGCCGAAGCAG
GGGGAGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail