Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|032380
Gene name
Locationscaffold_12:1169021..1172474
Strand-
Gene length (bp)3453
Transcript length (bp)3336
Coding sequence length (bp)3336
Protein length (aa) 1112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 1.8E-38 469 571
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.9E-37 441 537
PF17921 Integrase_H2C2 Integrase zinc binding domain 2.2E-19 685 741
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.0E-18 255 414
PF00665 rve Integrase core domain 1.0E-10 759 855
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 1.1E-09 1055 1104
PF08284 RVP_2 Retroviral aspartyl protease 2.4E-09 34 133
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 8.4E-08 27 117
PF13650 Asp_protease_2 Aspartyl protease 1.3E-06 25 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 1031 1.0E-131
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 1031 1.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 1031 1.0E-131
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 1031 1.0E-131
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 30 1031 4.0E-131
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 30 1031 4.0E-131
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 30 1031 6.0E-131
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 1039 2.0E-114
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 1041 1.0E-113
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 912 4.0E-70
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 108 915 1.0E-69
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 208 592 1.0E-50
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 591 9.0E-44
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 213 592 1.0E-40
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 19 591 2.0E-33
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 19 591 2.0E-32
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 213 591 2.0E-32
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 19 591 3.0E-32
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 19 591 6.0E-32
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 211 589 2.0E-31
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 17 591 6.0E-31
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 612 1005 1.0E-28
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 670 1009 4.0E-27
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 668 938 1.0E-25
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 676 936 5.0E-25
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 642 936 1.0E-24
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 677 938 3.0E-24
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 220 593 3.0E-24
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 676 936 1.0E-23
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 185 591 1.0E-23
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 185 591 1.0E-23
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 30 586 1.0E-22
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 222 597 2.0E-20
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 692 964 2.0E-19
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 30 586 1.0E-18
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 261 357 2.0E-18
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 30 585 7.0E-18
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 675 960 2.0E-17
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 201 591 3.0E-17
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 675 960 4.0E-17
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 780 1000 5.0E-17
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 756 1000 5.0E-17
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 780 1000 5.0E-17
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 241 591 6.0E-17
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 756 1000 6.0E-17
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 780 1000 7.0E-17
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 780 1000 7.0E-17
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 675 960 1.0E-16
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 780 1000 2.0E-16
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 780 1000 2.0E-16
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 780 1000 3.0E-16
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 780 1000 3.0E-16
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 765 1000 4.0E-16
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 651 1000 1.0E-15
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 668 1018 1.0E-15
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 675 960 1.0E-15
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 675 915 2.0E-15
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 649 1000 2.0E-15
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 649 975 7.0E-14
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 688 915 5.0E-13
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 677 915 1.0E-12
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 248 432 3.0E-12
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 33 591 4.0E-12
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 670 907 2.0E-11
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 702 987 3.0E-08
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 673 900 6.0E-08
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 757 915 3.0E-07
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 222 434 3.0E-07
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 222 388 3.0E-07
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 139 4.0E-07
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 691 907 6.0E-07
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 222 434 7.0E-07
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 222 434 1.0E-06
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 231 405 2.0E-06
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 210 424 3.0E-06
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 19 378 6.0E-06
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 439 504 9.0E-06
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 199 431 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|032380
MNNRYVVPQKRLGVQELEVKPLLTTTNGKKLKVSAMVDSGCTHTCIDEGLVKKKKIPTKKLERPITCRNSDGTIA
GKKDITKFAKIDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGMIKFNRCPTSCSFPHTDISFEP
RIRRLQSNEDTEEKEPDPTNPEDLPAYMKPFAHLFNRKNFDKLPERTEWDHEINFTENAPTEISSKVYSMTPLER
EELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNEITIKDKTPLPLISEVLDQLRDAKVFNK
LDIIWGYNNVRIREGDEWKAAFLTNRGLFEPTVMFFGMSNSPATFSRMMATIFREMIQDGSLANYMDDFIIPAKD
DEELEARTLRFLKIAEKHNLSFKRTKCEFNVSSTTVLGTVIGNGKATMEEEKVKAIRDWAGEKWYWNDEQQQAFE
QIKQAIASEPVLALPKDKGQFRVEVDASNYGTGAVLSQEQEDKWHPVAFMSKTLSEAERNYEIYDKELLAIIKAL
KLWRHYLLDAKEQFEIWTDHENLKYFREPQKLNARQARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPDTSND
NRGVEMFKEKMFIRRLEESIPIYDVTLLHNRRFEIIADETLLEKIRKCERRETRVIEEMKKQPEKVWENNGIIYR
QGRIYVPDNQEIRDFILHDHHNSPDAGHPGTYRMLESIKRTFWWPTIKTDIRRYVRGCDMCQKNKTIRRPDHIPL
NPLSIPDKPWEEISIDMIGPLPKSKEKDAIIVIVDRFSKMIHLVPTTTSLTSMDLAEIYKEEVWRHHGIPKRIIS
DRGPQFASKFMESLCKALSIERNLSTAYHPQTDGQTERMNQEIETYLRAFINYRQDDWTRWLPMVEFHYNDKTHA
ATGQTPFFLNYGLHPWKGNITVETTNPTATSLIEELENVRKEAKAAMEANNEMMRERGNNKHHKEPFAEGDKVWL
ETTNIHSNRPTRKLDHKRYGPFEILKQIGDRSYKLKLPDTWAIHDVFHTSLLTKVRDPEFDSQKKPTPPPPDIIN
EEEEYEVEEIRGHRRKGRGIQFLVHWKGYENEDDSWIPRSSLENAEEALSEYRAKLPNGQL*
Coding >AgabiH97|032380
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTGAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGGATTA
GTAAAGAAGAAGAAAATCCCGACGAAGAAATTGGAACGGCCGATCACATGCAGGAACTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAATGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAATCCTCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAATGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTAGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGACTATAGGAAACTAAACGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCATTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCTGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAAGAC
GATGAAGAATTGGAAGCACGAACTTTACGTTTTCTCAAAATCGCAGAGAAACACAATTTATCATTCAAACGGACG
AAATGCGAGTTCAACGTCTCATCAACAACGGTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCGGGGGAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAA
CAAATCAAGCAAGCTATCGCCAGCGAACCGGTCTTAGCGTTACCCAAGGACAAAGGACAATTCAGAGTCGAAGTA
GACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCACCCAGTCGCCTTCATG
TCGAAAACATTATCTGAAGCCGAACGAAACTACGAGATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTG
AAACTATGGCGACACTACCTATTGGACGCAAAGGAGCAATTTGAGATATGGACAGATCACGAGAACCTCAAATAT
TTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATACGATTTCCTACTA
CGACACATTCCTGGGAAGACGAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCTGACACATCTAACGAC
AACCGAGGAGTAGAAATGTTCAAGGAGAAAATGTTCATCCGAAGACTTGAAGAATCCATTCCCATCTATGACGTC
ACCTTACTCCACAATCGAAGATTCGAAATCATAGCCGATGAAACCCTACTTGAGAAGATTAGGAAATGTGAAAGA
CGAGAAACCAGAGTAATAGAAGAGATGAAGAAGCAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGA
CAAGGAAGGATCTATGTTCCGGATAATCAGGAGATCAGAGATTTCATTCTTCACGATCATCATAATTCCCCCGAC
GCCGGACATCCTGGAACGTACCGAATGCTAGAATCAATTAAACGGACCTTTTGGTGGCCCACAATCAAAACGGAT
ATCAGAAGATATGTCAGAGGATGCGACATGTGCCAGAAGAACAAAACCATTCGACGACCCGATCACATCCCGCTT
AATCCATTATCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATCGGACCACTACCGAAGTCAAAG
GAAAAGGATGCTATTATTGTTATCGTTGATAGGTTCTCCAAAATGATCCACCTCGTTCCCACTACCACGTCGCTC
ACGTCCATGGATCTTGCGGAAATCTATAAGGAAGAAGTCTGGCGACATCATGGAATTCCGAAACGGATTATTAGC
GACAGAGGACCACAGTTTGCATCGAAATTTATGGAATCCTTATGCAAAGCTCTAAGCATTGAACGGAACCTTTCT
ACGGCCTACCACCCACAGACAGACGGTCAAACAGAGCGGATGAATCAGGAAATTGAAACCTACCTTCGAGCATTC
ATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGTGGAATTCCATTACAATGACAAAACCCACGCT
GCCACCGGACAAACCCCATTCTTCCTGAATTACGGACTTCATCCATGGAAAGGAAATATCACGGTTGAAACGACA
AACCCCACCGCCACCTCCTTGATCGAAGAATTAGAGAATGTGCGAAAAGAAGCTAAAGCTGCGATGGAAGCAAAC
AACGAGATGATGAGAGAAAGAGGAAACAACAAGCACCACAAGGAACCCTTTGCCGAAGGAGATAAAGTTTGGTTA
GAAACGACGAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCCTTCGAGATCTTG
AAACAAATCGGCGATCGATCTTACAAACTGAAGCTACCTGATACCTGGGCGATACATGACGTCTTCCACACATCG
CTCCTAACGAAAGTCCGAGACCCAGAGTTTGACAGTCAGAAGAAACCCACTCCACCTCCACCTGACATTATCAAT
GAAGAAGAAGAATACGAAGTTGAAGAAATCCGAGGACACCGACGAAAAGGCCGAGGAATACAATTTTTAGTTCAC
TGGAAAGGATATGAAAACGAAGACGACTCTTGGATACCACGCTCATCCCTAGAAAATGCAGAAGAAGCACTCTCC
GAATATAGAGCAAAACTTCCGAATGGACAGTTATAA
Transcript >AgabiH97|032380
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTGAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGGATTA
GTAAAGAAGAAGAAAATCCCGACGAAGAAATTGGAACGGCCGATCACATGCAGGAACTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAATGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAATCCTCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAATGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTAGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGACTATAGGAAACTAAACGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCATTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCTGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAAGAC
GATGAAGAATTGGAAGCACGAACTTTACGTTTTCTCAAAATCGCAGAGAAACACAATTTATCATTCAAACGGACG
AAATGCGAGTTCAACGTCTCATCAACAACGGTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCGGGGGAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAA
CAAATCAAGCAAGCTATCGCCAGCGAACCGGTCTTAGCGTTACCCAAGGACAAAGGACAATTCAGAGTCGAAGTA
GACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCACCCAGTCGCCTTCATG
TCGAAAACATTATCTGAAGCCGAACGAAACTACGAGATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTG
AAACTATGGCGACACTACCTATTGGACGCAAAGGAGCAATTTGAGATATGGACAGATCACGAGAACCTCAAATAT
TTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATACGATTTCCTACTA
CGACACATTCCTGGGAAGACGAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCTGACACATCTAACGAC
AACCGAGGAGTAGAAATGTTCAAGGAGAAAATGTTCATCCGAAGACTTGAAGAATCCATTCCCATCTATGACGTC
ACCTTACTCCACAATCGAAGATTCGAAATCATAGCCGATGAAACCCTACTTGAGAAGATTAGGAAATGTGAAAGA
CGAGAAACCAGAGTAATAGAAGAGATGAAGAAGCAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGA
CAAGGAAGGATCTATGTTCCGGATAATCAGGAGATCAGAGATTTCATTCTTCACGATCATCATAATTCCCCCGAC
GCCGGACATCCTGGAACGTACCGAATGCTAGAATCAATTAAACGGACCTTTTGGTGGCCCACAATCAAAACGGAT
ATCAGAAGATATGTCAGAGGATGCGACATGTGCCAGAAGAACAAAACCATTCGACGACCCGATCACATCCCGCTT
AATCCATTATCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATCGGACCACTACCGAAGTCAAAG
GAAAAGGATGCTATTATTGTTATCGTTGATAGGTTCTCCAAAATGATCCACCTCGTTCCCACTACCACGTCGCTC
ACGTCCATGGATCTTGCGGAAATCTATAAGGAAGAAGTCTGGCGACATCATGGAATTCCGAAACGGATTATTAGC
GACAGAGGACCACAGTTTGCATCGAAATTTATGGAATCCTTATGCAAAGCTCTAAGCATTGAACGGAACCTTTCT
ACGGCCTACCACCCACAGACAGACGGTCAAACAGAGCGGATGAATCAGGAAATTGAAACCTACCTTCGAGCATTC
ATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGTGGAATTCCATTACAATGACAAAACCCACGCT
GCCACCGGACAAACCCCATTCTTCCTGAATTACGGACTTCATCCATGGAAAGGAAATATCACGGTTGAAACGACA
AACCCCACCGCCACCTCCTTGATCGAAGAATTAGAGAATGTGCGAAAAGAAGCTAAAGCTGCGATGGAAGCAAAC
AACGAGATGATGAGAGAAAGAGGAAACAACAAGCACCACAAGGAACCCTTTGCCGAAGGAGATAAAGTTTGGTTA
GAAACGACGAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCCTTCGAGATCTTG
AAACAAATCGGCGATCGATCTTACAAACTGAAGCTACCTGATACCTGGGCGATACATGACGTCTTCCACACATCG
CTCCTAACGAAAGTCCGAGACCCAGAGTTTGACAGTCAGAAGAAACCCACTCCACCTCCACCTGACATTATCAAT
GAAGAAGAAGAATACGAAGTTGAAGAAATCCGAGGACACCGACGAAAAGGCCGAGGAATACAATTTTTAGTTCAC
TGGAAAGGATATGAAAACGAAGACGACTCTTGGATACCACGCTCATCCCTAGAAAATGCAGAAGAAGCACTCTCC
GAATATAGAGCAAAACTTCCGAATGGACAGTTATAA
Gene >AgabiH97|032380
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTGAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGGATTA
GTAAAGAAGAAGAAAATCCCGACGAAGAAATTGGAACGGCCGATCACATGCAGGAACTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAATGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAATCCTCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAATGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTAGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGACTATAGGAAACTAAACGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCATTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCTGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAAGAC
GATGAAGAATTGGAAGCACGAACTTTACGTTTTCTCAAAATCGCAGAGAAACACAATTTATCATTCAAACGGACG
AAATGCGAGTTCAACGTCTCATCAACAACGGTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCGGTCCCTACCACGGTCAAACAAGTCGAAAGTTTTTTAGGTTTTGCC
AACTTCTATCGATGATTTATTAAAAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAGCAAGCTATCGCCAGCGAACCGGTC
TTAGCGTTACCCAAGGACAAAGGACAATTCAGAGTCGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAGGAAGACAAATGGCACCCAGTCGCCTTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAG
GAGCAATTTGAGATATGGACAGATCACGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAA
GCGAGATGGTACCTCATGCTACAGGAATACGATTTCCTACTACGACACATTCCTGGGAAGACGAACACCAAAGCA
GACATCCTGTCGAGACTAATCAAACCTGACACATCTAACGACAACCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATTCCCATCTATGACGTCACCTTACTCCACAATCGAAGATTCGAAATCATA
GCCGATGAAACCCTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAATCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCCCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAGAA
TCAATTAAACGGACCTTTTGGTGGCCCACAATCAAAACGGATATCAGAAGATATGTCAGAGGATGCGACATGTGC
CAGAAGAACAAAACCATTCGACGACCCGATCACATCCCGCTTAATCCATTATCCATCCCCGACAAACCTTGGGAA
GAAATATCTATAGACATGATCGGACCACTACCGAAGTCAAAGGAAAAGGATGCTATTATTGTTATCGTTGATAGG
TTCTCCAAAATGATCCACCTCGTTCCCACTACCACGTCGCTCACGTCCATGGATCTTGCGGAAATCTATAAGGAA
GAAGTCTGGCGACATCATGGAATTCCGAAACGGATTATTAGCGACAGAGGACCACAGTTTGCATCGAAATTTATG
GAATCCTTATGCAAAGCTCTAAGCATTGAACGGAACCTTTCTACGGCCTACCACCCACAGACAGACGGTCAAACA
GAGCGGATGAATCAGGAAATTGAAACCTACCTTCGAGCATTCATCAATTATCGACAAGACGATTGGACGAGATGG
CTTCCCATGGTGGAATTCCATTACAATGACAAAACCCACGCTGCCACCGGACAAACCCCATTCTTCCTGAATTAC
GGACTTCATCCATGGAAAGGAAATATCACGGTTGAAACGACAAACCCCACCGCCACCTCCTTGATCGAAGAATTA
GAGAATGTGCGAAAAGAAGCTAAAGCTGCGATGGAAGCAAACAACGAGATGATGAGAGAAAGAGGAAACAACAAG
CACCACAAGGAACCCTTTGCCGAAGGAGATAAAGTTTGGTTAGAAACGACGAACATTCATTCCAATCGTCCGACT
CGGAAACTAGACCACAAACGATATGGACCCTTCGAGATCTTGAAACAAATCGGCGATCGATCTTACAAACTGAAG
CTACCTGATACCTGGGCGATACATGACGTCTTCCACACATCGCTCCTAACGAAAGTCCGAGACCCAGAGTTTGAC
AGTCAGAAGAAACCCACTCCACCTCCACCTGACATTATCAATGAAGAAGAAGAATACGAAGTTGAAGAAATCCGA
GGACACCGACGAAAAGGCCGAGGAATACAATTTTTAGTTCACTGGAAAGGATATGAAAACGAAGACGACTCTTGG
ATACCACGCTCATCCCTAGAAAATGCAGAAGAAGCACTCTCCGAATATAGAGCAAAACTTCCGAATGGACAGTTA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail