Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|032050
Gene name
Locationscaffold_12:1066565..1068898
Strand+
Gene length (bp)2333
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 7.3E-59 31 325
PF05199 GMC_oxred_C GMC oxidoreductase 1.2E-31 424 562

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0R4L2|PDH3_LEUMG Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris GN=pdh3 PE=2 SV=1 13 566 5.0E-116
sp|Q3L245|PDH1_LEUMG Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris GN=pdh1 PE=1 SV=1 11 570 7.0E-113
sp|V5NC32|PDH1_AGAXA Pyranose dehydrogenase OS=Agaricus xanthodermus GN=pdh1 PE=1 SV=1 13 570 2.0E-112
sp|Q3L1D1|PDH1_AGABI Pyranose dehydrogenase OS=Agaricus bisporus GN=pdh1 PE=1 SV=1 19 570 4.0E-112
sp|V5NDL4|PDH1_AGACM Pyranose dehydrogenase OS=Agaricus campestris GN=pdh1 PE=1 SV=1 3 570 3.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0R4L2|PDH3_LEUMG Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris GN=pdh3 PE=2 SV=1 13 566 5.0E-116
sp|Q3L245|PDH1_LEUMG Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris GN=pdh1 PE=1 SV=1 11 570 7.0E-113
sp|V5NC32|PDH1_AGAXA Pyranose dehydrogenase OS=Agaricus xanthodermus GN=pdh1 PE=1 SV=1 13 570 2.0E-112
sp|Q3L1D1|PDH1_AGABI Pyranose dehydrogenase OS=Agaricus bisporus GN=pdh1 PE=1 SV=1 19 570 4.0E-112
sp|V5NDL4|PDH1_AGACM Pyranose dehydrogenase OS=Agaricus campestris GN=pdh1 PE=1 SV=1 3 570 3.0E-108
sp|Q3L243|PDH2_LEUMG Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris GN=pdh2 PE=2 SV=1 31 566 5.0E-105
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 31 576 4.0E-67
sp|P64264|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1 32 567 6.0E-67
sp|P9WMV5|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1279 PE=1 SV=1 32 567 6.0E-67
sp|P9WMV4|Y1279_MYCTO Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1316 PE=3 SV=1 32 567 6.0E-67
sp|Q6UPE0|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1 28 575 5.0E-65
sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1 31 566 5.0E-65
sp|P18173|DHGL_DROME Glucose dehydrogenase [FAD, quinone] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 30 572 9.0E-65
sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=1 SV=2 27 575 5.0E-64
sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 26 576 8.0E-64
sp|A7N2P9|BETA_VIBCB Oxygen-dependent choline dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betA PE=3 SV=1 31 569 9.0E-64
sp|P18172|DHGL_DROPS Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 30 572 3.0E-63
sp|Q7MF12|BETA_VIBVY Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betA PE=3 SV=1 31 566 5.0E-63
sp|Q8G1Z8|BETA_BRUSU Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betA PE=3 SV=1 32 568 3.0E-62
sp|Q8D3K2|BETA_VIBVU Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betA PE=3 SV=1 31 566 5.0E-62
sp|B0CKN4|BETA_BRUSI Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betA PE=3 SV=1 32 568 1.0E-61
sp|A5VPA6|BETA_BRUO2 Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betA PE=3 SV=1 32 568 1.0E-61
sp|A9M9H8|BETA_BRUC2 Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betA PE=3 SV=1 32 568 2.0E-61
sp|Q47944|SDH_GLUOY L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans PE=3 SV=1 31 569 4.0E-61
sp|Q8YFY2|BETA_BRUME Oxygen-dependent choline dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betA PE=3 SV=2 32 568 1.0E-60
sp|B4EHJ2|BETA_BURCJ Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=betA PE=3 SV=1 26 568 1.0E-60
sp|Q12062|AFLK_ASPPA Versicolorin B synthase OS=Aspergillus parasiticus GN=vbs PE=1 SV=1 31 568 2.0E-60
sp|Q88CW6|BETA_PSEPK Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betA PE=3 SV=1 28 568 4.0E-60
sp|A0B2F7|BETA_BURCH Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=betA PE=3 SV=1 26 568 6.0E-60
sp|Q1BQE2|BETA_BURCA Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=betA PE=3 SV=1 26 568 6.0E-60
sp|B5ZUG2|BETA_RHILW Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betA PE=3 SV=1 32 568 7.0E-60
sp|B1K707|BETA_BURCC Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=betA PE=3 SV=1 26 568 7.0E-60
sp|B1Z034|BETA_BURA4 Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=betA PE=3 SV=1 26 568 1.0E-59
sp|A9AMZ9|BETA_BURM1 Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=betA PE=3 SV=1 26 568 1.0E-59
sp|Q1MJU4|BETA_RHIL3 Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1 32 568 1.0E-59
sp|Q0B711|BETA_BURCM Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=betA PE=3 SV=1 26 568 2.0E-59
sp|Q1IG70|BETA_PSEE4 Oxygen-dependent choline dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betA PE=3 SV=1 28 568 2.0E-59
sp|A5WA97|BETA_PSEP1 Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betA PE=3 SV=1 28 568 3.0E-59
sp|Q6LGH5|BETA_PHOPR Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum GN=betA PE=3 SV=1 31 569 6.0E-59
sp|A6X2G7|BETA_OCHA4 Oxygen-dependent choline dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=betA PE=3 SV=1 32 568 8.0E-59
sp|B0KN19|BETA_PSEPG Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betA PE=3 SV=1 28 568 1.0E-58
sp|Q2KB43|BETA_RHIEC Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betA PE=3 SV=1 32 568 1.0E-58
sp|Q39A44|BETA_BURL3 Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=betA PE=3 SV=1 26 568 1.0E-58
sp|C3MIE4|BETA_RHISN Oxygen-dependent choline dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betA PE=3 SV=1 32 568 2.0E-58
sp|A6U6Y8|BETA_SINMW Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betA PE=3 SV=1 32 568 2.0E-58
sp|B2JS89|BETA_BURP8 Oxygen-dependent choline dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betA PE=3 SV=1 26 568 3.0E-58
sp|Q3JLL7|BETA_BURP1 Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=betA PE=3 SV=1 26 567 3.0E-58
sp|C3K3D3|BETA_PSEFS Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=betA PE=3 SV=1 28 568 6.0E-58
sp|Q2T6D0|BETA_BURTA Oxygen-dependent choline dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=betA PE=3 SV=1 26 567 7.0E-58
sp|Q1QXE1|BETA1_CHRSD Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA1 PE=3 SV=1 25 568 7.0E-58
sp|Q3K5H3|BETA_PSEPF Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=betA PE=3 SV=1 28 568 7.0E-58
sp|Q4A0Q1|BETA_STAS1 Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=betA PE=3 SV=1 31 568 1.0E-57
sp|Q62CH8|BETA_BURMA Oxygen-dependent choline dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=betA PE=3 SV=1 26 567 1.0E-57
sp|Q63KK7|BETA_BURPS Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=betA PE=3 SV=1 26 567 1.0E-57
sp|Q4K4K7|BETA_PSEF5 Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=betA PE=3 SV=1 28 568 2.0E-57
sp|B3PTE0|BETA_RHIE6 Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=betA PE=3 SV=1 32 568 2.0E-57
sp|A4JJG6|BETA_BURVG Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=betA PE=3 SV=1 26 568 2.0E-57
sp|A7MFA8|BETA_CROS8 Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=betA PE=3 SV=1 30 568 3.0E-57
sp|Q9X2M2|BETA_STAXY Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus GN=betA PE=3 SV=1 28 568 3.0E-57
sp|Q985M5|BETA_RHILO Oxygen-dependent choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1 32 568 4.0E-57
sp|Q8NUM0|BETA_STAAW Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=betA PE=3 SV=1 27 568 8.0E-57
sp|Q6G664|BETA_STAAS Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=betA PE=3 SV=1 27 568 8.0E-57
sp|P54223|BETA_RHIME Oxygen-dependent choline dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=betA PE=3 SV=2 32 568 1.0E-56
sp|B1JSR0|BETA_YERPY Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=betA PE=3 SV=1 30 568 1.0E-56
sp|A7FKL6|BETA_YERP3 Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=betA PE=3 SV=1 30 568 1.0E-56
sp|Q8UH55|BETA_AGRFC Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=betA PE=3 SV=2 32 568 1.0E-56
sp|Q1CFR7|BETA_YERPN Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=betA PE=3 SV=1 30 568 2.0E-56
sp|Q8ZGW0|BETA_YERPE Oxygen-dependent choline dehydrogenase OS=Yersinia pestis GN=betA PE=3 SV=1 30 568 2.0E-56
sp|Q1C932|BETA_YERPA Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=betA PE=3 SV=1 30 568 2.0E-56
sp|A8Z5A4|BETA_STAAT Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|Q6GDJ1|BETA_STAAR Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|P60337|BETA_STAAN Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain N315) GN=betA PE=1 SV=1 27 568 6.0E-56
sp|P60336|BETA_STAAM Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|A6QK99|BETA_STAAE Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain Newman) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|Q5HCU1|BETA_STAAC Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain COL) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|Q2YWJ5|BETA_STAAB Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|A5IW37|BETA_STAA9 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain JH9) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|Q2FV11|BETA_STAA8 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|Q2FDP9|BETA_STAA3 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|A6U4Z2|BETA_STAA2 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain JH1) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|A7X6Z3|BETA_STAA1 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=betA PE=3 SV=1 27 568 6.0E-56
sp|Q6D6D9|BETA_PECAS Oxygen-dependent choline dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=betA PE=3 SV=1 30 567 6.0E-56
sp|Q66D54|BETA_YERPS Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betA PE=3 SV=1 30 568 6.0E-56
sp|B2K8U4|BETA_YERPB Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betA PE=3 SV=1 30 568 6.0E-56
sp|B9JBA2|BETA_AGRRK Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betA PE=3 SV=1 32 568 6.0E-56
sp|A4XPI5|BETA_PSEMY Oxygen-dependent choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betA PE=3 SV=1 28 567 9.0E-56
sp|A4TNP2|BETA_YERPP Oxygen-dependent choline dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=betA PE=3 SV=1 30 568 3.0E-55
sp|Q13NG7|BETA_BURXL Oxygen-dependent choline dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=betA PE=3 SV=1 28 568 4.0E-55
sp|Q9L4K0|BETA2_CHRSD Oxygen-dependent choline dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA PE=3 SV=1 30 568 4.0E-55
sp|A8AJN0|BETA_CITK8 Oxygen-dependent choline dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=betA PE=3 SV=1 31 568 5.0E-55
sp|C6DKY4|BETA_PECCP Oxygen-dependent choline dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=betA PE=3 SV=1 30 567 1.0E-54
sp|Q4ZM63|BETA_PSEU2 Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betA PE=3 SV=1 30 568 1.0E-54
sp|B0V945|BETA_ACIBY Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=betA PE=3 SV=1 26 573 2.0E-54
sp|B0VST3|BETA_ACIBS Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=betA PE=3 SV=1 26 573 2.0E-54
sp|B2HV79|BETA_ACIBC Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=betA PE=3 SV=1 26 573 2.0E-54
sp|B7I895|BETA_ACIB5 Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=betA PE=3 SV=1 26 573 2.0E-54
sp|B7GYG5|BETA_ACIB3 Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=betA PE=3 SV=1 26 573 2.0E-54
sp|B4SHV9|BETA_STRM5 Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=betA PE=3 SV=1 29 568 2.0E-54
sp|Q48CM7|BETA_PSE14 Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betA PE=3 SV=1 30 568 2.0E-54
sp|B2FQ89|BETA_STRMK Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=betA PE=3 SV=1 29 568 3.0E-54
sp|A8GBX9|BETA_SERP5 Oxygen-dependent choline dehydrogenase OS=Serratia proteamaculans (strain 568) GN=betA PE=3 SV=1 30 567 5.0E-54
sp|Q3BXK8|BETA_XANC5 Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betA PE=3 SV=1 30 568 9.0E-54
sp|Q8CMY2|BETA_STAES Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=betA PE=3 SV=1 27 568 2.0E-53
sp|B2TCJ8|BETA_BURPP Oxygen-dependent choline dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=betA PE=3 SV=1 28 568 2.0E-53
sp|B5Z1R0|BETA_ECO5E Oxygen-dependent choline dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=betA PE=3 SV=1 30 573 2.0E-53
sp|Q8X6C6|BETA_ECO57 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O157:H7 GN=betA PE=3 SV=1 30 573 2.0E-53
sp|B7UJG4|BETA_ECO27 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=betA PE=3 SV=1 30 573 2.0E-53
sp|Q5HL11|BETA_STAEQ Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=betA PE=3 SV=1 27 568 2.0E-53
sp|B7N8L3|BETA_ECOLU Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betA PE=3 SV=1 30 568 3.0E-53
sp|B6I074|BETA_ECOSE Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SE11) GN=betA PE=3 SV=1 30 573 4.0E-53
sp|A7ZWV4|BETA_ECOHS Oxygen-dependent choline dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betA PE=3 SV=1 30 573 4.0E-53
sp|B7M2V5|BETA_ECO8A Oxygen-dependent choline dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=betA PE=3 SV=1 30 573 4.0E-53
sp|B7L439|BETA_ECO55 Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=betA PE=3 SV=1 30 573 4.0E-53
sp|A7ZI50|BETA_ECO24 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=betA PE=3 SV=1 30 573 4.0E-53
sp|Q8PPG8|BETA_XANAC Oxygen-dependent choline dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=betA PE=3 SV=1 30 568 6.0E-53
sp|P17444|BETA_ECOLI Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12) GN=betA PE=1 SV=1 30 573 7.0E-53
sp|B1J0W6|BETA_ECOLC Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betA PE=3 SV=1 30 573 7.0E-53
sp|B1XE52|BETA_ECODH Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betA PE=3 SV=1 30 573 7.0E-53
sp|Q1RFM3|BETA_ECOUT Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=betA PE=3 SV=2 30 568 9.0E-53
sp|B7MCD0|BETA_ECO45 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=betA PE=3 SV=1 30 568 9.0E-53
sp|Q0T7N0|BETA_SHIF8 Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betA PE=3 SV=1 30 568 1.0E-52
sp|Q6FDF9|BETA_ACIAD Oxygen-dependent choline dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=betA PE=3 SV=1 26 567 1.0E-52
sp|B1LIJ7|BETA_ECOSM Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betA PE=3 SV=1 30 568 1.0E-52
sp|Q8P5D7|BETA_XANCP Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=betA PE=3 SV=1 30 568 2.0E-52
sp|B0RNU9|BETA_XANCB Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betA PE=3 SV=1 30 568 2.0E-52
sp|Q4UYN5|BETA_XANC8 Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betA PE=3 SV=1 30 568 2.0E-52
sp|Q88AE7|BETA_PSESM Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betA PE=3 SV=1 30 568 3.0E-52
sp|B4EX94|BETA_PROMH Oxygen-dependent choline dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=betA PE=3 SV=1 31 568 3.0E-52
sp|Q0TKW1|BETA_ECOL5 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betA PE=3 SV=2 30 573 5.0E-52
sp|Q8FKI9|BETA_ECOL6 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=betA PE=3 SV=2 30 573 6.0E-52
sp|A6T613|BETA_KLEP7 Oxygen-dependent choline dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=betA PE=3 SV=1 30 568 1.0E-51
sp|B5Y008|BETA_KLEP3 Oxygen-dependent choline dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=betA PE=3 SV=1 30 568 1.0E-51
sp|Q4L9D7|BETA_STAHJ Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=betA PE=3 SV=1 27 568 2.0E-51
sp|Q9HTJ2|BETA_PSEAE Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=betA PE=3 SV=1 28 568 7.0E-51
sp|B7V5R3|BETA_PSEA8 Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=betA PE=3 SV=1 28 568 7.0E-51
sp|Q02DZ0|BETA_PSEAB Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betA PE=3 SV=1 28 568 8.0E-51
sp|Q9AJD6|PNO_MICLT Pyridoxine 4-oxidase OS=Microbacterium luteolum GN=pno PE=1 SV=3 30 560 1.0E-50
sp|E4QP00|HMFO_METS6 5-(hydroxymethyl)furfural oxidase OS=Methylovorus sp. (strain MP688) GN=MPQ_0130 PE=1 SV=1 31 566 3.0E-50
sp|A6VEI3|BETA_PSEA7 Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betA PE=3 SV=1 28 568 1.0E-49
sp|Q00922|ALOX_CANBO Alcohol oxidase OS=Candida boidinii GN=AOD1 PE=1 SV=1 29 571 7.0E-45
sp|P04841|ALOX_PICAN Alcohol oxidase OS=Pichia angusta GN=MOX PE=1 SV=1 29 464 2.0E-42
sp|C4R702|ALOX2_PICPG Alcohol oxidase 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=AOX2 PE=3 SV=1 29 464 7.0E-42
sp|F2R038|ALOX2_PICP7 Alcohol oxidase 2 OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=AOX2 PE=2 SV=1 29 464 7.0E-42
sp|P04842|ALOX1_PICPG Alcohol oxidase 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=AOX1 PE=1 SV=2 29 464 3.0E-41
sp|F2QY27|ALOX1_PICP7 Alcohol oxidase 1 OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=AOX1 PE=1 SV=1 29 464 3.0E-41
sp|Q7X2H8|CHOX_ARTGO Choline oxidase OS=Arthrobacter globiformis GN=codA PE=1 SV=1 24 567 6.0E-40
sp|P13006|GOX_ASPNG Glucose oxidase OS=Aspergillus niger GN=gox PE=1 SV=1 32 572 3.0E-38
sp|P46371|YTH2_RHOER Uncharacterized GMC-type oxidoreductase in thcA 5'region OS=Rhodococcus erythropolis PE=3 SV=1 27 569 9.0E-38
sp|P81156|GOX_PENAG Glucose oxidase OS=Penicillium amagasakiense PE=1 SV=1 7 574 9.0E-36
sp|Q92452|GOX_TALFL Glucose oxidase OS=Talaromyces flavus GN=GOX PE=3 SV=1 6 574 4.0E-34
sp|Q9VGP2|NINAG_DROME Neither inactivation nor afterpotential protein G OS=Drosophila melanogaster GN=ninaG PE=2 SV=2 13 566 1.0E-29
sp|Q5UPK7|YL128_MIMIV Putative GMC-type oxidoreductase L128 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L128 PE=3 SV=1 32 568 9.0E-27
sp|Q945K2|MDL2_PRUDU (R)-mandelonitrile lyase 2 OS=Prunus dulcis GN=MDL2 PE=1 SV=1 31 567 2.0E-23
sp|P52706|MDL1_PRUSE (R)-mandelonitrile lyase 1 OS=Prunus serotina GN=MDL1 PE=1 SV=1 31 567 2.0E-23
sp|Q9SSM2|MDLL_ARATH (R)-mandelonitrile lyase-like OS=Arabidopsis thaliana GN=At1g73050 PE=2 SV=1 23 541 3.0E-22
sp|O82784|MDL4_PRUSE (R)-mandelonitrile lyase 4 OS=Prunus serotina GN=MDL4 PE=2 SV=1 5 561 1.0E-21
sp|O50048|MDL2_PRUSE (R)-mandelonitrile lyase 2 OS=Prunus serotina GN=MDL2 PE=2 SV=1 5 561 3.0E-21
sp|P52707|MDL3_PRUSE (R)-mandelonitrile lyase 3 OS=Prunus serotina GN=MDL3 PE=2 SV=1 31 561 1.0E-20
sp|O24243|MDL1_PRUDU (R)-mandelonitrile lyase 1 OS=Prunus dulcis GN=MDL1 PE=2 SV=1 5 565 3.0E-20
sp|Q5UQH9|YR832_MIMIV Putative truncated GMC-type inactive oxidoreductase R832 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R832 PE=3 SV=1 32 326 8.0E-16
sp|Q9S746|HTH_ARATH Protein HOTHEAD OS=Arabidopsis thaliana GN=HTH PE=1 SV=1 31 328 4.0E-14
sp|Q5UPL2|YR135_MIMIV Putative GMC-type oxidoreductase R135 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R135 PE=1 SV=1 32 323 4.0E-12
sp|Q01738|CDH_PHACH Cellobiose dehydrogenase OS=Phanerochaete chrysosporium GN=CDH-1 PE=1 SV=1 26 573 1.0E-11
sp|Q5UQZ1|YL894_MIMIV Putative truncated GMC-type inactive oxidoreductase L894 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L894 PE=1 SV=1 32 329 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|032050
MKRLFAWLPFVGIVNGAVYNDISEVINSDKFDFVIVGGGTAGSVIANRLSENPEFQVMVIEDGSLVGDDLNIKVP
FNVFSLSNTRFDWNFTSTPQDGLNGRTVPYARGHVLGGSSCINAMFYTRGSSDDYDRFAQITGDSGWSWDSLQPY
IQKNEKWTAPADQHDTTGQFNPSVHSTTGMTSVSLPGFSQEIDDMVIETTTQLAWLQSTIGNGARSSAAASYLSD
EVTQRSNLHIVLGTRATRILPTPRGNSSKTSLRTVELLSTSGETTLINAKKEVILSAGTIGTPTILLHSGIGDKT
TFESLGINSVVDLPDVGKNLVDHPTMSVSWNTTSTNPFDGLVVNATLKAEQLNVWKDNRTGALTTLGINQVAFLR
IPDNSDIFSQFPDPSSGKNSPHIELAIGSGMTSFIPGHFVGVGASIVAPASKGSVQINSSNPLAMPLIDPGLLSS
AFDVKALVQSVKSAIRFFGAPAWDDFVLDIAGPIGSATTDEELEAIIRSSVFPSGHIVGTAAMSATDADHGVVDP
DLKLKHASGLRIVDASIMPFIITGHTQAPVYIIAERAADLIKGDWGSPALS*
Coding >AgabiH97|032050
ATGAAGCGCCTGTTCGCTTGGCTTCCTTTTGTGGGCATTGTCAACGGCGCTGTCTACAATGACATTTCCGAAGTA
ATCAATTCAGATAAGTTTGATTTCGTCATCGTTGGAGGTGGAACCGCCGGTTCGGTCATTGCCAATAGATTGTCG
GAAAATCCCGAATTCCAAGTGATGGTTATTGAAGATGGGTCTTTAGTTGGTGACGACCTCAACATAAAAGTTCCC
TTCAATGTGTTTTCGCTGTCGAATACTCGTTTTGACTGGAATTTTACCTCAACACCTCAAGATGGACTCAATGGT
CGTACAGTTCCTTATGCTCGAGGGCACGTTCTCGGGGGTTCTAGCTGCATAAATGCAATGTTTTACACCCGAGGA
TCTTCTGACGATTACGATCGGTTCGCCCAAATCACTGGAGATTCCGGTTGGTCCTGGGATAGCCTTCAACCTTAC
ATTCAGAAGAATGAGAAGTGGACAGCTCCTGCGGATCAGCATGATACCACTGGCCAATTTAATCCGTCTGTGCAT
AGCACTACTGGAATGACTTCAGTCAGTCTTCCTGGATTTTCGCAAGAAATTGACGACATGGTGATTGAAACGACA
ACCCAACTGGCATGGCTACAATCAACCATTGGCAATGGTGCGAGAAGCAGCGCAGCTGCTTCATACCTGAGTGAT
GAGGTTACTCAACGTTCGAATCTTCATATTGTACTCGGGACTCGGGCAACGAGAATACTTCCTACCCCAAGAGGA
AATAGCTCGAAGACGTCCCTGCGCACAGTAGAGCTTCTTTCAACTTCCGGCGAAACGACTTTGATCAACGCCAAA
AAGGAAGTTATTCTCTCTGCAGGCACCATTGGCACGCCGACAATTCTACTACATTCCGGTATTGGTGACAAAACT
ACCTTTGAAAGCCTTGGCATAAATTCTGTCGTTGATCTACCGGACGTTGGCAAGAACCTAGTTGATCATCCAACA
ATGTCCGTTAGCTGGAACACAACCTCTACAAATCCCTTTGACGGTCTAGTGGTGAATGCGACTCTGAAAGCTGAA
CAGTTGAACGTTTGGAAGGATAATCGGACAGGTGCTTTAACCACCTTAGGAATCAACCAGGTTGCCTTCCTCAGA
ATTCCCGACAACTCAGACATCTTCAGTCAATTCCCCGATCCATCCTCCGGGAAAAACTCACCTCACATCGAGCTC
GCTATAGGAAGCGGTATGACAAGTTTCATTCCTGGACATTTTGTCGGTGTGGGGGCCAGCATAGTGGCACCTGCG
TCTAAGGGTTCTGTCCAAATCAACTCCAGTAATCCACTGGCGATGCCACTGATTGATCCTGGGTTGCTTAGTTCT
GCATTTGATGTGAAGGCATTAGTGCAATCCGTCAAGAGTGCAATCCGATTCTTTGGTGCTCCTGCTTGGGACGAC
TTTGTGCTGGATATCGCTGGTCCTATAGGAAGCGCGACGACGGACGAGGAACTTGAAGCAATCATTCGTAGTAGC
GTCTTCCCTTCTGGACATATTGTTGGGACAGCAGCAATGTCCGCGACGGACGCTGATCATGGTGTCGTTGACCCT
GACCTAAAGCTCAAGCATGCGTCGGGCCTAAGAATCGTCGACGCGTCTATCATGCCATTCATTATCACAGGGCAC
ACACAGGCGCCAGTTTACATTATTGCCGAGAGGGCAGCAGATCTCATCAAGGGAGACTGGGGATCACCGGCACTG
TCATAG
Transcript >AgabiH97|032050
ATGAAGCGCCTGTTCGCTTGGCTTCCTTTTGTGGGCATTGTCAACGGCGCTGTCTACAATGACATTTCCGAAGTA
ATCAATTCAGATAAGTTTGATTTCGTCATCGTTGGAGGTGGAACCGCCGGTTCGGTCATTGCCAATAGATTGTCG
GAAAATCCCGAATTCCAAGTGATGGTTATTGAAGATGGGTCTTTAGTTGGTGACGACCTCAACATAAAAGTTCCC
TTCAATGTGTTTTCGCTGTCGAATACTCGTTTTGACTGGAATTTTACCTCAACACCTCAAGATGGACTCAATGGT
CGTACAGTTCCTTATGCTCGAGGGCACGTTCTCGGGGGTTCTAGCTGCATAAATGCAATGTTTTACACCCGAGGA
TCTTCTGACGATTACGATCGGTTCGCCCAAATCACTGGAGATTCCGGTTGGTCCTGGGATAGCCTTCAACCTTAC
ATTCAGAAGAATGAGAAGTGGACAGCTCCTGCGGATCAGCATGATACCACTGGCCAATTTAATCCGTCTGTGCAT
AGCACTACTGGAATGACTTCAGTCAGTCTTCCTGGATTTTCGCAAGAAATTGACGACATGGTGATTGAAACGACA
ACCCAACTGGCATGGCTACAATCAACCATTGGCAATGGTGCGAGAAGCAGCGCAGCTGCTTCATACCTGAGTGAT
GAGGTTACTCAACGTTCGAATCTTCATATTGTACTCGGGACTCGGGCAACGAGAATACTTCCTACCCCAAGAGGA
AATAGCTCGAAGACGTCCCTGCGCACAGTAGAGCTTCTTTCAACTTCCGGCGAAACGACTTTGATCAACGCCAAA
AAGGAAGTTATTCTCTCTGCAGGCACCATTGGCACGCCGACAATTCTACTACATTCCGGTATTGGTGACAAAACT
ACCTTTGAAAGCCTTGGCATAAATTCTGTCGTTGATCTACCGGACGTTGGCAAGAACCTAGTTGATCATCCAACA
ATGTCCGTTAGCTGGAACACAACCTCTACAAATCCCTTTGACGGTCTAGTGGTGAATGCGACTCTGAAAGCTGAA
CAGTTGAACGTTTGGAAGGATAATCGGACAGGTGCTTTAACCACCTTAGGAATCAACCAGGTTGCCTTCCTCAGA
ATTCCCGACAACTCAGACATCTTCAGTCAATTCCCCGATCCATCCTCCGGGAAAAACTCACCTCACATCGAGCTC
GCTATAGGAAGCGGTATGACAAGTTTCATTCCTGGACATTTTGTCGGTGTGGGGGCCAGCATAGTGGCACCTGCG
TCTAAGGGTTCTGTCCAAATCAACTCCAGTAATCCACTGGCGATGCCACTGATTGATCCTGGGTTGCTTAGTTCT
GCATTTGATGTGAAGGCATTAGTGCAATCCGTCAAGAGTGCAATCCGATTCTTTGGTGCTCCTGCTTGGGACGAC
TTTGTGCTGGATATCGCTGGTCCTATAGGAAGCGCGACGACGGACGAGGAACTTGAAGCAATCATTCGTAGTAGC
GTCTTCCCTTCTGGACATATTGTTGGGACAGCAGCAATGTCCGCGACGGACGCTGATCATGGTGTCGTTGACCCT
GACCTAAAGCTCAAGCATGCGTCGGGCCTAAGAATCGTCGACGCGTCTATCATGCCATTCATTATCACAGGGCAC
ACACAGGCGCCAGTTTACATTATTGCCGAGAGGGCAGCAGATCTCATCAAGGGAGACTGGGGATCACCGGCACTG
TCATAG
Gene >AgabiH97|032050
ATGAAGCGCCTGTTCGCTTGGCTTCCTTTTGTGGGCATTGTCAACGGCGCTGTCTACAATGACATTTCCGAAGTA
ATCAATTCAGATAAGTTTGATTTCGTCATCGTTGGAGGTAAAGCTCTTGTTTTACCCAATCATGTTTTGCACCAT
CCCTAACTGAATGTCTACAAAGGTGGAACCGCCGGTTCGGTCATTGCCAATAGATTGTCGGAAAATCCCGAATTC
CAAGTGATGGTTATTGAAGATGGGTCTTTGTGAGTAAATCATGTCCATGTCTTGCGCTTTGAGCTCGCTGCTCAA
CCTTCCGTCATGATAGAGTTGGTGACGACCTCAACATAAAAGTTCCCTTCAATGTGTTTTCGCTGTCGAATACTC
GTTTTGACTGGAATTTTACCTCAACACCTCAAGATGGACTCAATGGTCGTACAGTTCCTTATGCTCGAGGGCACG
TTCTCGGGGGTTCTAGCTGCATAAGTAAATGATTTTAAGTTTGCGAGGACGGTTTCTGATCTTTGAATCAGATGC
AATGTTTTACACCCGAGGATCTTCTGACGATTACGATCGGTTCGCCCAAATCACTGGAGATTCCGGTTGGTCCTG
GGATAGCCTTCAACCTTACATTCAGAAGGTTCGTGAACTCCTATTTTCAAACTTCCACGAAGTTTTGCTCCATTG
TAGTTTAACTGACTACGACCACGTGGCGTTCAGAATGAGAAGTGGACAGCTCCTGCGGATCAGCATGATACCACT
GGCCAATTTAATCCGTCTGTGCATAGCACTACTGGAATGACTTCAGTCAGTCTTCCTGGATTTTCGCAAGAAATT
GACGACATGGTGATTGAAACGACAACCCAACTGGGTAACGAGTTCCCTTTCAATCTAGATATGAATTCCGGGAAG
CCATTAGGCTTGGGCAAGTCCACTAGCCACTCGTCTTAAAAAATGAATATGACTAACTGTAGGGATTAGCATGGC
TACAATCAACCATTGGCAATGGTGCGAGAAGCAGCGCAGCTGCTTCATACCTGAGTGATGAGGTTACTCAACGTT
CGAATCTTCATATTGTACTCGGGACTCGGGCAACGAGAATACTTCCTACCCCAAGAGGAAATAGCTCGAAGACGT
CCCTGCGCACAGTAGAGCTTCTTTCAACTTCCGGTGAGTGCAAATATGAACATATCGTCCTTCTCTTACATCCGG
ATCCAGGCGAAACGACTTTGATCAACGCCAAAAAGGAAGTTATTCTCTCTGCAGGCACCATTGGCACGCCGACAA
TTCTACTACATTCCGGTATTGGTGACAAAACTACCTTTGAAAGCCTTGGCATAAATTCTGTCGTTGATCTACCGG
ACGTTGGCAAGAACCTAGTTGATCATCCAACAATGTCCGTTAGCTGGAACACAACCTCTACAAATCCCTTTGACG
GGTAGGTCAAAATAAGCTACCTTTGAATGACCTAACGCTCTTTTAGTCTAGTGGTGAATGCGACTCTGAAAGCTG
AACAGTTGAACGTTTGGAAGGATAATCGGACAGGTGCTTTAACCACCTTAGGAATCAACCAGGTTGCCTTCCTCA
GAATTCCCGACAACTCAGACATCTTCAGTCAATTCCCCGATCCATCCTCCGGGAAAAACTCACCTCACATCGAGC
TCGCTATAGGAGTACGTACTAGAAATCTGCTTGCAATCAGGTACCTGTTAACCCTTACCATAGAGCGGTATGACA
AGTTTCATTCCTGGACATTTTGTCGGTGTGGGGGCCAGCATAGTGGCACCTGCGTCTAGTGAGTAATTGAAAATG
TGGATAGTAAAAGACTGATGCAATTCGCAGAGGGTTCTGTCCAAATCAACTCCAGTAATCCACTGGCGATGCCAC
TGATTGATCCTGGGTTGCTTAGTTCTGCATTTGATGTGAAGGCATTAGTGCAATCCGTCAAGAGTGCAATCCGAT
TCTTTGGTGCTCCTGCTTGGGACGACTTTGTGCTGGATATCGCTGGTCCTATAGGAAGCGCGACGACGGACGAGG
AACTTGAAGCAATCATTCGTAGTAGCGTCTTCCCTTCTGGACATATTGTTGGGACAGCAGCAATGTCCGCGACGG
ACGCTGATCATGGTGTCGTTGACCCTGACCTAAAGCTCAAGCATGCGTCGGGCCTAAGAATCGTCGACGCGTCTA
TCATGGTAAGCAATTAATGAGTTCTCGTTTCGTCGCGTAACTCATCTTCGCAATAGCCATTCATTATCACAGGGC
ACACACAGGCGCCAGTTTACATTATTGCCGAGAGGGCAGCAGATCTCATCAAGGGAGACTGGGGATCACCGGCAC
TGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail