Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|032010
Gene name
Locationscaffold_12:1052388..1054509
Strand+
Gene length (bp)2121
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54PR9|CF60_DICDI Counting factor 60 OS=Dictyostelium discoideum GN=cf60 PE=1 SV=1 84 414 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|032010
MRSISPLWVLLGIAVSFTEAVNVVYYPPDQTHINNLTNVLHSTEAPGIFNSSHTPDSIYGIYNWCNMPHVRTKEY
KTPSSQYKLVYVEAIQRHQKRTPYASNTYFEEIIGWDCVNQGRTVGLHSTSFQETTVEWQAEFPSNNPFTKTVGP
GFINSTCIFPGITSEGQDDARVHGEDLREVYFKRLGLGEAYDSKTARVRVTNNVITSEVASGSCRGLWPKTDVVP
VSIEEPVIDSLEPSYPCPNADVIRNNYTTGDGGAVWLNHLTAAAPLFDKLDSISGIEKNDTGGWHISLDHNYDNL
SAKQCHGKPLSCDRNDTSTCVSQEEANMVYNFGNWEYSYIFRDAPESADYSCKKYGAFFLQLQDHLQQVMDGKSS
MKFMYNIAHDGSMAPMLGCLQISQMVWPGMGAEVTYELYEGPSNGNSGPGQCNSDITSRDDNSHGSDNHGNDNHG
NNGHGNNGHGNSGNGKQQYYLRVMWGGKPMKTSTPMGTLDLIPVETFFDYIAQYVGTGEELVQLCQST*
Coding >AgabiH97|032010
ATGCGCTCCATCTCGCCTCTGTGGGTCCTCCTTGGGATCGCTGTCTCGTTCACTGAGGCAGTGAATGTCGTTTAT
TACCCTCCCGATCAAACTCACATCAACAACTTGACCAACGTCCTCCATTCGACAGAGGCCCCAGGCATCTTCAAC
TCGTCTCACACTCCAGACAGTATATATGGTATCTATAACTGGTGTAACATGCCGCACGTCCGTACCAAGGAGTAC
AAGACTCCTTCGTCACAATACAAGCTAGTGTATGTGGAAGCCATTCAACGTCATCAAAAGCGTACTCCATACGCT
TCGAACACTTACTTTGAGGAAATAATTGGCTGGGATTGTGTCAACCAAGGGCGCACAGTTGGACTTCACAGCACA
TCGTTCCAAGAGACGACGGTTGAGTGGCAAGCCGAGTTCCCCTCGAACAATCCGTTCACAAAAACGGTAGGTCCA
GGATTCATAAATAGCACTTGCATTTTCCCCGGAATCACTTCCGAAGGTCAGGACGATGCGAGGGTCCACGGTGAA
GATCTAAGAGAGGTCTACTTCAAGCGTCTTGGCCTTGGCGAAGCGTATGACAGCAAGACGGCTCGAGTCCGCGTG
ACGAACAATGTGATCACTTCCGAAGTTGCGTCTGGTTCGTGCAGAGGACTTTGGCCGAAGACCGACGTTGTTCCT
GTTTCAATCGAGGAGCCGGTAATCGACTCCCTTGAACCTAGCTACCCCTGTCCCAATGCCGACGTCATCAGGAAC
AATTATACGACCGGTGATGGAGGTGCTGTATGGCTAAACCATTTGACTGCCGCAGCTCCTCTCTTCGACAAGCTA
GACAGTATCTCTGGGATCGAGAAGAACGATACAGGAGGATGGCATATAAGTCTCGACCACAACTACGACAACCTG
AGTGCAAAGCAGTGCCATGGAAAACCACTTTCCTGTGATAGGAACGATACTTCGACGTGTGTTTCACAAGAGGAA
GCCAACATGGTCTACAACTTTGGTAACTGGGAATACTCATACATATTCCGTGATGCCCCAGAATCAGCCGATTAC
TCCTGCAAGAAATATGGTGCCTTTTTCCTACAGCTGCAGGATCATCTCCAACAAGTTATGGATGGCAAATCCAGC
ATGAAATTCATGTACAATATTGCTCATGATGGATCTATGGCGCCTATGTTGGGCTGTTTGCAAATCAGTCAAATG
GTCTGGCCGGGAATGGGAGCTGAGGTGACATACGAGCTGTATGAAGGTCCATCTAATGGCAACAGTGGTCCTGGC
CAGTGCAACAGCGACATCACCAGCAGGGACGACAACAGTCATGGCAGTGACAATCACGGCAATGACAACCACGGC
AATAACGGACATGGCAATAACGGGCATGGCAACAGCGGGAACGGCAAGCAGCAGTACTACTTGCGTGTGATGTGG
GGAGGAAAACCGATGAAGACTTCGACACCTATGGGTACTCTTGATCTAATTCCGGTCGAGACATTCTTTGACTAC
ATTGCGCAATACGTTGGTACTGGTGAGGAGCTTGTGCAGCTATGCCAGTCTACTTGA
Transcript >AgabiH97|032010
ATGCGCTCCATCTCGCCTCTGTGGGTCCTCCTTGGGATCGCTGTCTCGTTCACTGAGGCAGTGAATGTCGTTTAT
TACCCTCCCGATCAAACTCACATCAACAACTTGACCAACGTCCTCCATTCGACAGAGGCCCCAGGCATCTTCAAC
TCGTCTCACACTCCAGACAGTATATATGGTATCTATAACTGGTGTAACATGCCGCACGTCCGTACCAAGGAGTAC
AAGACTCCTTCGTCACAATACAAGCTAGTGTATGTGGAAGCCATTCAACGTCATCAAAAGCGTACTCCATACGCT
TCGAACACTTACTTTGAGGAAATAATTGGCTGGGATTGTGTCAACCAAGGGCGCACAGTTGGACTTCACAGCACA
TCGTTCCAAGAGACGACGGTTGAGTGGCAAGCCGAGTTCCCCTCGAACAATCCGTTCACAAAAACGGTAGGTCCA
GGATTCATAAATAGCACTTGCATTTTCCCCGGAATCACTTCCGAAGGTCAGGACGATGCGAGGGTCCACGGTGAA
GATCTAAGAGAGGTCTACTTCAAGCGTCTTGGCCTTGGCGAAGCGTATGACAGCAAGACGGCTCGAGTCCGCGTG
ACGAACAATGTGATCACTTCCGAAGTTGCGTCTGGTTCGTGCAGAGGACTTTGGCCGAAGACCGACGTTGTTCCT
GTTTCAATCGAGGAGCCGGTAATCGACTCCCTTGAACCTAGCTACCCCTGTCCCAATGCCGACGTCATCAGGAAC
AATTATACGACCGGTGATGGAGGTGCTGTATGGCTAAACCATTTGACTGCCGCAGCTCCTCTCTTCGACAAGCTA
GACAGTATCTCTGGGATCGAGAAGAACGATACAGGAGGATGGCATATAAGTCTCGACCACAACTACGACAACCTG
AGTGCAAAGCAGTGCCATGGAAAACCACTTTCCTGTGATAGGAACGATACTTCGACGTGTGTTTCACAAGAGGAA
GCCAACATGGTCTACAACTTTGGTAACTGGGAATACTCATACATATTCCGTGATGCCCCAGAATCAGCCGATTAC
TCCTGCAAGAAATATGGTGCCTTTTTCCTACAGCTGCAGGATCATCTCCAACAAGTTATGGATGGCAAATCCAGC
ATGAAATTCATGTACAATATTGCTCATGATGGATCTATGGCGCCTATGTTGGGCTGTTTGCAAATCAGTCAAATG
GTCTGGCCGGGAATGGGAGCTGAGGTGACATACGAGCTGTATGAAGGTCCATCTAATGGCAACAGTGGTCCTGGC
CAGTGCAACAGCGACATCACCAGCAGGGACGACAACAGTCATGGCAGTGACAATCACGGCAATGACAACCACGGC
AATAACGGACATGGCAATAACGGGCATGGCAACAGCGGGAACGGCAAGCAGCAGTACTACTTGCGTGTGATGTGG
GGAGGAAAACCGATGAAGACTTCGACACCTATGGGTACTCTTGATCTAATTCCGGTCGAGACATTCTTTGACTAC
ATTGCGCAATACGTTGGTACTGGTGAGGAGCTTGTGCAGCTATGCCAGTCTACTTGA
Gene >AgabiH97|032010
ATGCGCTCCATCTCGCCTCTGTGGGTCCTCCTTGGGATCGCTGTCTCGTTCACTGAGGCAGTGAATGTCGTTTAT
TACCCTCCCGATCAAACTCACATCAACAACTTGACCAACGTCCTCCATTCGACAGAGGCCCCAGGCATCTTCAAC
TCGTCTCACACTCCAGACAGTATATATGGTATCTATAACTGGTGTAACATGCCGCACGTCCGTACCAAGGAGTAC
AAGTACGTAAATGTCTGTTCCTTACACGTAACTCAATGTTGATCGCCCCTCCATCAAAACCAGGACTCCTTCGTC
ACAATACAAGCTAGTGTATGTGGAAGCCATTCAACGTCATCAAAAGCGTACTCCATACGCTTCGAACACTTACTT
TGAGGAAATAATTGGCTGGGATTGTGTCAACCAAGGGCGCACAGTTGGACTTCACAGGTATGCTTTTGGGGTCTG
GCAATCGATTTCAGCCGTTTACTCAAGTGTTGTAGCACATCGTTCCAAGAGACGACGGTTGAGGTGCGTTCAATG
ACTTGCTTCAGTGTCAGCGAGTTACACTGTCTTACATCTGCTAGTGGCAAGCCGAGTTCCCCTCGAACAATCCGT
TCACAAAAACGGTAGGTCCAGGATTCATAAATAGCACGTACGTTTTACAATGTTTGCCTACTACTTCCATCTTCT
GAAGCTTCTTCAGTTGCATTTTCCCCGGAATCACTTCCGAAGGTCAGGACGATGCGAGGGTCCACGGTGAAGTGT
GTACTCTTAACGTCAACACAGACACCACAGGACTAACGATTATATGCAGGATCTAAGAGAGGTCTACTTCAAGCG
TCTTGGCCTTGGCGAAGCGTATGACAGCAAGACGGCTCGAGTCCGTGAGTCTCGTTTTCGGATCTACAACTATCC
CTCTTCGTTGACTCTTGATTTTAGGCGTGACGAACAATGTGATCACTTCCGAAGTTGCGTCTGGTTCGTGCAGAG
GACTTTGGCCGAAGACCGACGTTGTTCCTGTTTCAATCGAGGAGCCGGTAATCGACTCCCTTGAACCTAGCTACC
CCTGTCCCAATGCCGACGTCATCAGGAACAATTATACGACCGGTGATGGAGGTGCTGTATGGCTAAACCATTTGA
CTGCCGCAGCTCCTCTCTTCGACAAGCTAGACAGTATCTCTGGGATCGAGAAGAACGATACAGGAGGATGGCATA
TAAGTCTCGACCAGTGAGTATCGCCTCCCGCATAAGTAATTTTTCTTCCATGGCAACTCAATTTTAACTATAGCA
ACTACGACAACCTGAGTGCAAAGCAGTGCCATGGAAAACCACTTTCCTGTGATAGGAACGATACTTCGACGTGTG
TTTCACAAGAGGAAGTAGGTCCCTTCAATCTATGATTTTGTGAGCCGTGGTTAACTGTTTCGTTTTTTATTCGGT
ATAGGCCAACATGGTCTACAACTTTGGTAACTGGGAATACTCATACATATTCCGTGATGCCCCAGAATCAGCCGA
TTACTCCTGCAAGAAATATGGTGCCTTTTTCCTACAGCTGCAGGATCATCTCCAACAAGTTATGGATGGCAAATC
CAGCATGAAATTCATGTACAATGTACGCTATGGGCTCGCCCTCTTCTTCAGGAAGCAGCTTATAATAAACTACTG
TTTAGATTGCTCATGATGGATCTATGGCGCCTATGTTGGGCTGTTTGCAAATCAGTCAAATGGTCTGGCCGGGAA
TGGGAGCTGAGGTGACATACGAGCTGTATGAAGGTCCATCTAATGGCAACAGTGGTCCTGGCCAGTGCAACAGCG
ACATCACCAGCAGGGACGACAACAGTCATGGCAGTGACAATCACGGCAATGACAACCACGGCAATAACGGACATG
GCAATAACGGGCATGGCAACAGCGGGAACGGCAAGCAGCAGTACTACTTGCGTGTGATGTGGGGAGGAAAACCGA
TGAAGACTTCGACACCTATGGGTACTCTTGATCTAATTCCGGTCGAGACATTCTTTGACTGTAAACCATCTTCTC
TTTTTACCAAAACGACTTCTGACGAAACACTTTATAGACATTGCGCAATACGTTGGTACTGGTGAGGAGCTTGTG
CAGCTATGCCAGTCTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail