Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031980
Gene name
Locationscaffold_12:1043877..1046425
Strand-
Gene length (bp)2548
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 8.3E-16 214 315
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 4.8E-22 495 603

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 86 621 1.0E-28

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide 0.1345 0.0851 0.485 0.5156 0.1698 0.0147 0.2175 0.5055 0.1857 0.0715

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999068

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 655 677 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA5_1 6.0E-219 26 623

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 177.90 87.60 268.20
Initials Initials knots 71.35 42.44 100.26
Pileal_Stipeal_center Stage I stipe center 167.77 93.47 242.07
Pileal_Stipeal_shell Stage I stipe shell 100.68 58.90 142.46
DIF_stipe_center Stage II stipe center 161.69 89.97 233.40
DIF_stipe_shell Stage II stipe shell 227.19 120.67 333.70
DIF_stipe_skin Stage II stipe skin 167.96 93.55 242.37
DIF_cap_skin Stage II cap skin 162.55 90.33 234.76
DIF_cap_tissue Stage II cap tissue 167.89 92.82 242.96
DIF_gill_tissue Stage II gill tissue 127.50 72.82 182.18
YFB_stipe_center Young fruiting body stipe center 180.93 99.52 262.34
YFB_stipe_shell Young fruiting body stipe shell 214.50 115.24 313.76
YFB_stipe_skin Young fruiting body stipe skin 162.14 89.72 234.57
YFB_cap_skin Young fruiting body cap skin 157.36 87.85 226.87
YFB_cap_tissue Young fruiting body cap tissue 246.28 128.71 363.85
YFB_gill_tissue Young fruiting body gill tissue 136.17 77.50 194.84
YFB_veil Young fruiting body veil 129.49 73.82 185.16

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.379989 no
Casing YFB_stipe_center 0.979616 no
Casing YFB_stipe_shell 0.700039 no
Casing YFB_stipe_skin 0.870568 no
Casing YFB_cap_skin 0.821698 no
Casing YFB_cap_tissue 0.426553 no
Casing YFB_gill_tissue 0.507610 no
Casing YFB_veil 0.404986 no
Casing Initials 0.001140 yes
Casing Pileal_Stipeal_center 0.924048 no
Casing Pileal_Stipeal_shell 0.065465 no
Casing DIF_stipe_center 0.866769 no
Casing DIF_stipe_shell 0.571988 no
Casing DIF_stipe_skin 0.924712 no
Casing DIF_cap_skin 0.877788 no
Casing DIF_cap_tissue 0.923050 no
DIF_gill_tissue YFB_stipe_center 0.312315 no
DIF_gill_tissue YFB_stipe_shell 0.089641 no
DIF_gill_tissue YFB_stipe_skin 0.530314 no
DIF_gill_tissue YFB_cap_skin 0.605922 no
DIF_gill_tissue YFB_cap_tissue 0.024444 yes
DIF_gill_tissue YFB_gill_tissue 0.900765 no
DIF_gill_tissue YFB_veil 0.978115 no
YFB_stipe_center YFB_stipe_shell 0.717812 no
YFB_stipe_center YFB_stipe_skin 0.830889 no
YFB_stipe_center YFB_cap_skin 0.775007 no
YFB_stipe_center YFB_cap_tissue 0.426833 no
YFB_stipe_center YFB_gill_tissue 0.441575 no
YFB_stipe_center YFB_veil 0.334972 no
YFB_stipe_shell YFB_stipe_skin 0.462544 no
YFB_stipe_shell YFB_cap_skin 0.404208 no
YFB_stipe_shell YFB_cap_tissue 0.789910 no
YFB_stipe_shell YFB_gill_tissue 0.154113 no
YFB_stipe_shell YFB_veil 0.105226 no
YFB_stipe_skin YFB_cap_skin 0.958703 no
YFB_stipe_skin YFB_cap_tissue 0.216412 no
YFB_stipe_skin YFB_gill_tissue 0.681508 no
YFB_stipe_skin YFB_veil 0.560358 no
YFB_cap_skin YFB_cap_tissue 0.178069 no
YFB_cap_skin YFB_gill_tissue 0.756525 no
YFB_cap_skin YFB_veil 0.642476 no
YFB_cap_tissue YFB_gill_tissue 0.056760 no
YFB_cap_tissue YFB_veil 0.030134 yes
YFB_gill_tissue YFB_veil 0.928675 no
Initials DIF_gill_tissue 0.033444 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.001625 yes
Initials YFB_cap_skin 0.001140 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.013485 yes
Initials YFB_veil 0.024946 yes
Initials Pileal_Stipeal_center 0.001625 yes
Initials Pileal_Stipeal_shell 0.269371 no
Initials DIF_stipe_center 0.002951 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.001625 yes
Initials DIF_cap_skin 0.001625 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.450247 no
Pileal_Stipeal_center YFB_stipe_center 0.889578 no
Pileal_Stipeal_center YFB_stipe_shell 0.532921 no
Pileal_Stipeal_center YFB_stipe_skin 0.953310 no
Pileal_Stipeal_center YFB_cap_skin 0.908862 no
Pileal_Stipeal_center YFB_cap_tissue 0.270160 no
Pileal_Stipeal_center YFB_gill_tissue 0.601692 no
Pileal_Stipeal_center YFB_veil 0.484931 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.075908 no
Pileal_Stipeal_center DIF_stipe_center 0.948846 no
Pileal_Stipeal_center DIF_stipe_shell 0.407743 no
Pileal_Stipeal_center DIF_stipe_skin 0.998164 no
Pileal_Stipeal_center DIF_cap_skin 0.956160 no
Pileal_Stipeal_center DIF_cap_tissue 0.998575 no
Pileal_Stipeal_shell DIF_gill_tissue 0.519893 no
Pileal_Stipeal_shell YFB_stipe_center 0.044201 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.007092 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.102511 no
Pileal_Stipeal_shell YFB_cap_skin 0.138696 no
Pileal_Stipeal_shell YFB_cap_tissue 0.001625 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.365801 no
Pileal_Stipeal_shell YFB_veil 0.481618 no
Pileal_Stipeal_shell DIF_stipe_center 0.106659 no
Pileal_Stipeal_shell DIF_stipe_shell 0.002951 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.078410 no
Pileal_Stipeal_shell DIF_cap_skin 0.104748 no
Pileal_Stipeal_shell DIF_cap_tissue 0.080883 no
DIF_stipe_center DIF_gill_tissue 0.539009 no
DIF_stipe_center YFB_stipe_center 0.827940 no
DIF_stipe_center YFB_stipe_shell 0.458448 no
DIF_stipe_center YFB_stipe_skin 0.996078 no
DIF_stipe_center YFB_cap_skin 0.964588 no
DIF_stipe_center YFB_cap_tissue 0.210546 no
DIF_stipe_center YFB_gill_tissue 0.691363 no
DIF_stipe_center YFB_veil 0.572988 no
DIF_stipe_center DIF_stipe_shell 0.334972 no
DIF_stipe_center DIF_stipe_skin 0.948481 no
DIF_stipe_center DIF_cap_skin 0.992840 no
DIF_stipe_center DIF_cap_tissue 0.949141 no
DIF_stipe_shell DIF_gill_tissue 0.052135 no
DIF_stipe_shell YFB_stipe_center 0.591040 no
DIF_stipe_shell YFB_stipe_shell 0.925263 no
DIF_stipe_shell YFB_stipe_skin 0.341405 no
DIF_stipe_shell YFB_cap_skin 0.291553 no
DIF_stipe_shell YFB_cap_tissue 0.891225 no
DIF_stipe_shell YFB_gill_tissue 0.094162 no
DIF_stipe_shell YFB_veil 0.057550 no
DIF_stipe_shell DIF_stipe_skin 0.417331 no
DIF_stipe_shell DIF_cap_skin 0.353442 no
DIF_stipe_shell DIF_cap_tissue 0.415808 no
DIF_stipe_skin DIF_gill_tissue 0.446558 no
DIF_stipe_skin YFB_stipe_center 0.892660 no
DIF_stipe_skin YFB_stipe_shell 0.539587 no
DIF_stipe_skin YFB_stipe_skin 0.952304 no
DIF_stipe_skin YFB_cap_skin 0.907585 no
DIF_stipe_skin YFB_cap_tissue 0.272348 no
DIF_stipe_skin YFB_gill_tissue 0.602202 no
DIF_stipe_skin YFB_veil 0.482879 no
DIF_stipe_skin DIF_cap_skin 0.955365 no
DIF_stipe_skin DIF_cap_tissue 0.999212 no
DIF_cap_skin DIF_gill_tissue 0.527470 no
DIF_cap_skin YFB_stipe_center 0.839234 no
DIF_cap_skin YFB_stipe_shell 0.469172 no
DIF_cap_skin YFB_stipe_skin 0.996520 no
DIF_cap_skin YFB_cap_skin 0.956385 no
DIF_cap_skin YFB_cap_tissue 0.223829 no
DIF_cap_skin YFB_gill_tissue 0.683536 no
DIF_cap_skin YFB_veil 0.561660 no
DIF_cap_skin DIF_cap_tissue 0.956426 no
DIF_cap_tissue DIF_gill_tissue 0.448765 no
DIF_cap_tissue YFB_stipe_center 0.890815 no
DIF_cap_tissue YFB_stipe_shell 0.538457 no
DIF_cap_tissue YFB_stipe_skin 0.952359 no
DIF_cap_tissue YFB_cap_skin 0.907706 no
DIF_cap_tissue YFB_cap_tissue 0.273950 no
DIF_cap_tissue YFB_gill_tissue 0.601985 no
DIF_cap_tissue YFB_veil 0.485218 no

Orthologs

Orthofinder run ID1
Orthogroup1124
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|031980
Agaricus bisporus var bisporus H39 AgabiH39|031990
Agaricus bisporus var bisporus H97 AgabiH97|031980 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|031990
Rhodonia placenta FPRL280 RhoplFPRL280|258_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031980
MTSLSRSFVALRLFLFFSCAISPSLSATAGSFADGGTTGVSAMMMILGNEDYVYILDKAEGNAEVINGHPAWGAV
WDTRTHEHQLMDVRSNVFCSSGMHLPNGSYVTFGGNSAVGPGGNTPTGSDGLPETWDPQYQDFDGAKAIRVLNPC
KSEQNIADPKCQWFDDATVLAMERRRWYSAAEALEDGSVIIMGGFVNGGYINRNYPNTDPEFEGGAADCTYEYYP
SRNQPAQTVQFLIQTSGLNAYALTYLMPSGQLFVQANVSTMLWDHNANVETPLPPMPGNVVRVYPASGANAMLPL
TPANNYEPTILFCGGSDMPESAFGNYAFPAINTFDYPASTDCQRITPEPQDGSEPVYTKDDDLLEGRTMGQFILL
PDGKILLVNGGANGTAGYSQMTGETPTFGQMPWGESLASGPRGTPALYDPEAPAGQRWSNTGFATSDIARLYHSS
AMLLADGSVLIAGSNPNVDVNTSTIFPTTYKAEIFYPSYFDATTRPAPSGIPTTLSYGGDYFNVTLPQTSYSGSA
NDAAAKTKVVLTRGGFTTHAMNMGQRYLQLNNTYTVQDDGTIVLHCAQPPPNPHILQPGPVVFWVVVDGIPSNGT
MVIVGNGQIGPQPVTDASTLPDSVLATNNVNGGASDSSGSGVDNNNSDSTTSIGAIVGGVVGGIAALAAIVGAVV
FFMRRRNAGGRGVYTQKAAPASTYDFGSTPLETTRGHIPIPSDSSSFVPLNQENRSVAWNAGSTASLHEAAGVSA
PYRDDPRTSSMGSGGGYGGYPMQEQNYDPYARAGPGGRL*
Coding >AgabiH97|031980
ATGACTAGTCTTTCACGGTCGTTTGTGGCGCTCCGCCTTTTTCTCTTCTTTTCGTGCGCTATCTCTCCTTCATTA
TCGGCAACCGCAGGCTCGTTTGCCGATGGGGGGACAACCGGTGTCAGTGCGATGATGATGATACTTGGGAATGAA
GACTATGTGTATATCCTCGATAAGGCGGAAGGAAATGCTGAAGTGATAAATGGACATCCAGCGTGGGGTGCTGTA
TGGGATACACGCACTCACGAGCATCAGCTCATGGATGTGCGAAGTAACGTCTTCTGTTCCTCGGGAATGCATCTT
CCCAATGGATCATATGTCACTTTTGGTGGAAACAGCGCTGTTGGTCCCGGTGGTAACACCCCGACTGGATCAGAT
GGCCTTCCGGAAACTTGGGACCCTCAATACCAAGATTTTGATGGAGCCAAAGCCATTCGAGTTCTCAACCCATGT
AAATCCGAGCAGAACATTGCCGATCCCAAGTGTCAGTGGTTTGACGATGCCACCGTATTGGCTATGGAGAGACGA
AGATGGTATTCGGCTGCTGAAGCGTTAGAAGACGGCAGTGTCATCATTATGGGAGGTTTCGTCAATGGTGGCTAT
ATCAACAGGAACTATCCAAATACCGATCCAGAATTTGAGGGTGGTGCTGCTGATTGTACCTACGAATATTACCCC
TCACGGAACCAACCGGCTCAGACTGTTCAATTTCTCATTCAAACCTCTGGCTTGAACGCCTATGCACTTACATAC
CTGATGCCTTCTGGTCAACTTTTCGTCCAGGCAAATGTGTCTACCATGCTATGGGATCACAATGCAAACGTCGAA
ACCCCTTTACCTCCCATGCCGGGCAATGTTGTCCGTGTATACCCCGCCTCAGGCGCAAATGCAATGCTCCCCCTT
ACCCCTGCAAACAATTATGAACCGACTATTCTTTTCTGCGGTGGCTCTGATATGCCTGAATCTGCTTTCGGCAAC
TACGCATTCCCCGCCATCAATACTTTTGATTATCCGGCTTCAACGGATTGCCAGCGCATCACGCCAGAGCCTCAG
GATGGCTCTGAGCCCGTCTATACCAAGGATGATGACTTGCTTGAGGGACGCACCATGGGTCAATTCATCCTTCTT
CCTGATGGAAAAATACTTCTCGTCAATGGAGGCGCAAATGGCACTGCTGGATATTCGCAAATGACAGGTGAGACT
CCCACGTTTGGTCAAATGCCATGGGGAGAGTCTCTTGCATCCGGACCTCGAGGAACGCCCGCACTCTATGACCCT
GAAGCTCCCGCTGGACAACGATGGTCTAACACAGGCTTCGCTACATCGGATATTGCGCGTCTTTACCACTCGTCA
GCTATGTTACTCGCTGATGGTTCGGTACTTATTGCCGGCTCGAATCCTAACGTGGACGTCAACACTTCGACCATC
TTCCCTACAACTTACAAGGCGGAGATTTTCTATCCTTCGTACTTTGATGCCACCACTCGTCCGGCTCCTTCTGGT
ATCCCGACAACCCTTTCATATGGAGGCGATTATTTCAATGTCACGCTTCCTCAGACCTCGTACAGTGGTTCGGCA
AACGATGCTGCAGCTAAGACCAAGGTTGTGCTTACTCGTGGTGGATTTACGACGCATGCGATGAACATGGGCCAG
AGATATCTTCAACTCAATAACACTTACACTGTCCAGGATGATGGTACCATTGTATTGCATTGTGCTCAACCACCT
CCGAACCCACACATTTTACAACCGGGACCCGTAGTATTCTGGGTGGTTGTTGATGGTATTCCGAGTAATGGAACA
ATGGTGATCGTTGGAAATGGCCAGATTGGTCCACAGCCTGTTACAGATGCGAGTACTCTACCCGATAGTGTGCTG
GCTACGAACAATGTGAATGGTGGCGCGTCGGATTCATCGGGTTCTGGTGTGGATAACAACAATTCGGACTCGACG
ACATCCATTGGGGCTATCGTTGGTGGTGTCGTTGGTGGTATAGCGGCTCTTGCTGCGATTGTCGGTGCAGTAGTA
TTCTTCATGAGAAGACGTAATGCTGGTGGACGTGGAGTGTATACACAGAAAGCCGCTCCTGCTTCGACATACGAT
TTTGGTTCAACTCCTTTGGAGACTACCAGAGGTCATATACCCATCCCATCGGATTCTAGTTCGTTCGTGCCCTTA
AACCAGGAGAATAGGAGTGTTGCTTGGAATGCTGGAAGTACGGCGAGTCTGCATGAAGCGGCGGGTGTGAGCGCG
CCTTATAGAGACGATCCGAGAACAAGTAGTATGGGAAGTGGGGGAGGGTATGGCGGATATCCTATGCAGGAACAA
AACTATGACCCGTATGCTAGGGCTGGGCCAGGTGGGAGATTGTGA
Transcript >AgabiH97|031980
ATGACTAGTCTTTCACGGTCGTTTGTGGCGCTCCGCCTTTTTCTCTTCTTTTCGTGCGCTATCTCTCCTTCATTA
TCGGCAACCGCAGGCTCGTTTGCCGATGGGGGGACAACCGGTGTCAGTGCGATGATGATGATACTTGGGAATGAA
GACTATGTGTATATCCTCGATAAGGCGGAAGGAAATGCTGAAGTGATAAATGGACATCCAGCGTGGGGTGCTGTA
TGGGATACACGCACTCACGAGCATCAGCTCATGGATGTGCGAAGTAACGTCTTCTGTTCCTCGGGAATGCATCTT
CCCAATGGATCATATGTCACTTTTGGTGGAAACAGCGCTGTTGGTCCCGGTGGTAACACCCCGACTGGATCAGAT
GGCCTTCCGGAAACTTGGGACCCTCAATACCAAGATTTTGATGGAGCCAAAGCCATTCGAGTTCTCAACCCATGT
AAATCCGAGCAGAACATTGCCGATCCCAAGTGTCAGTGGTTTGACGATGCCACCGTATTGGCTATGGAGAGACGA
AGATGGTATTCGGCTGCTGAAGCGTTAGAAGACGGCAGTGTCATCATTATGGGAGGTTTCGTCAATGGTGGCTAT
ATCAACAGGAACTATCCAAATACCGATCCAGAATTTGAGGGTGGTGCTGCTGATTGTACCTACGAATATTACCCC
TCACGGAACCAACCGGCTCAGACTGTTCAATTTCTCATTCAAACCTCTGGCTTGAACGCCTATGCACTTACATAC
CTGATGCCTTCTGGTCAACTTTTCGTCCAGGCAAATGTGTCTACCATGCTATGGGATCACAATGCAAACGTCGAA
ACCCCTTTACCTCCCATGCCGGGCAATGTTGTCCGTGTATACCCCGCCTCAGGCGCAAATGCAATGCTCCCCCTT
ACCCCTGCAAACAATTATGAACCGACTATTCTTTTCTGCGGTGGCTCTGATATGCCTGAATCTGCTTTCGGCAAC
TACGCATTCCCCGCCATCAATACTTTTGATTATCCGGCTTCAACGGATTGCCAGCGCATCACGCCAGAGCCTCAG
GATGGCTCTGAGCCCGTCTATACCAAGGATGATGACTTGCTTGAGGGACGCACCATGGGTCAATTCATCCTTCTT
CCTGATGGAAAAATACTTCTCGTCAATGGAGGCGCAAATGGCACTGCTGGATATTCGCAAATGACAGGTGAGACT
CCCACGTTTGGTCAAATGCCATGGGGAGAGTCTCTTGCATCCGGACCTCGAGGAACGCCCGCACTCTATGACCCT
GAAGCTCCCGCTGGACAACGATGGTCTAACACAGGCTTCGCTACATCGGATATTGCGCGTCTTTACCACTCGTCA
GCTATGTTACTCGCTGATGGTTCGGTACTTATTGCCGGCTCGAATCCTAACGTGGACGTCAACACTTCGACCATC
TTCCCTACAACTTACAAGGCGGAGATTTTCTATCCTTCGTACTTTGATGCCACCACTCGTCCGGCTCCTTCTGGT
ATCCCGACAACCCTTTCATATGGAGGCGATTATTTCAATGTCACGCTTCCTCAGACCTCGTACAGTGGTTCGGCA
AACGATGCTGCAGCTAAGACCAAGGTTGTGCTTACTCGTGGTGGATTTACGACGCATGCGATGAACATGGGCCAG
AGATATCTTCAACTCAATAACACTTACACTGTCCAGGATGATGGTACCATTGTATTGCATTGTGCTCAACCACCT
CCGAACCCACACATTTTACAACCGGGACCCGTAGTATTCTGGGTGGTTGTTGATGGTATTCCGAGTAATGGAACA
ATGGTGATCGTTGGAAATGGCCAGATTGGTCCACAGCCTGTTACAGATGCGAGTACTCTACCCGATAGTGTGCTG
GCTACGAACAATGTGAATGGTGGCGCGTCGGATTCATCGGGTTCTGGTGTGGATAACAACAATTCGGACTCGACG
ACATCCATTGGGGCTATCGTTGGTGGTGTCGTTGGTGGTATAGCGGCTCTTGCTGCGATTGTCGGTGCAGTAGTA
TTCTTCATGAGAAGACGTAATGCTGGTGGACGTGGAGTGTATACACAGAAAGCCGCTCCTGCTTCGACATACGAT
TTTGGTTCAACTCCTTTGGAGACTACCAGAGGTCATATACCCATCCCATCGGATTCTAGTTCGTTCGTGCCCTTA
AACCAGGAGAATAGGAGTGTTGCTTGGAATGCTGGAAGTACGGCGAGTCTGCATGAAGCGGCGGGTGTGAGCGCG
CCTTATAGAGACGATCCGAGAACAAGTAGTATGGGAAGTGGGGGAGGGTATGGCGGATATCCTATGCAGGAACAA
AACTATGACCCGTATGCTAGGGCTGGGCCAGGTGGGAGATTGTGA
Gene >AgabiH97|031980
ATGACTAGTCTTTCACGGTCGTTTGTGGCGCTCCGCCTTTTTCTCTTCTTTTCGTGCGCTATCTCTCCTTCATTA
TCGGCAACCGCAGGCTCGTTTGCCGATGGGGGGACAACCGGTGTCAGTGCGATGATGGTGAGCCTTCTCAAAATC
TTCTTTATGATTTTTCGTTCATGACTGTCCTCGTTTAGATGATACTTGGGAATGAAGACTATGTGTATATCCTCG
ATAAGGCGGAAGGAAATGCTGAAGTGATAAATGGACATCCAGCGTGGGGTGCTGTATGGTGTGTAATCATTCTTT
TAAACTGGTGTTGTCTATACGCAGTGAATGTTGATACCTCTGTTTACGTTATTAGGGATACACGCACTCACGAGC
ATCAGCTCATGGATGTGCGAAGTAACGTCTTCTGTTCCTCGGGAATGCATCTTCCCAATGGATCATATGTCACTT
TTGGTGGAAACAGCGCTGTTGGTCCCGGTGGTAACACCCCGACTGGATCAGATGGCCTTCCGGAAACTTGGGACC
CTCAATACCAAGATTTTGATGGAGCCAAAGCCATTCGAGTTCTCAACCCATGTAAATCCGAGCAGAACATTGCCG
ATCCCAAGTGTCAGTGGTTTGACGATGCCACCGTATTGGCTATGGAGAGACGAAGATGGTATTCGGCTGCTGAAG
CGTTAGAAGACGGCAGTGTCATCATTATGGGAGGTTTCGTCAATGGTGGCTATATCAACAGGAACTATCCAAATA
CCGATCCAGAATTTGAGGGTGGTGCTGCTGATTGTACCTACGAATATTACCCCTCACGGAACCAACCGGCTCAGA
CTGTTCAATTTCTCATTCAAACCTCTGGCTTGAACGCCTATGCACTTACATACCTGATGCCTTCTGGTCAACTTT
TCGTCCAGGCAAATGTGTCTACCAGTGAGTTACAGCTTTTCTCCATTGATGTGGCGATACTGAACCGCCTGAAGT
GCTATGGGATCACAATGCAAACGTCGAAACCCCTTTACCTCCCATGCCGGGCAATGTTGTCCGTGTATACCCCGC
CTCAGGCGCAAATGCAATGCTCCCCCTTACCCCTGCAAACAATTATGAACCGACTATTCTTTTCTGCGGTGGCTC
TGATATGCCTGAATCTGCTTTCGGCAACTACGCATTCCCCGCCATCAATACTTTTGATTATCCGGCTTCAACGGA
TTGCCAGCGCATCACGCCAGAGCCTCAGGATGGCTCTGAGCCCGTCTATACCAAGGATGATGACTTGCTTGAGGG
ACGCACCATGGGTCAATTCATCCTTCTTCCTGATGGAAAAATACTTCTCGTCAATGGAGGCGCAAATGGCACTGC
TGGATATTCGCAAATGACAGGTGAGACTCCCACGTTTGGTCAAATGCCATGGGGAGAGTCTCTTGCATCCGGACC
TCGAGGAACGCCCGCACTCTATGACCCTGAAGCTCCCGCTGGACAACGATGGTCTAACACAGGCTTCGCTACATC
GGATATTGCGCGTCTTTACCACTCGTCAGCTATGTTACTCGCTGATGGTTCGGTACTTATTGCCGGCTCGAATCC
TAACGTGGACGTCAACACTTCGACCATCTTCCCTACAACTTACAAGGCGGAGATTTTCTATCCTTCGTACTTTGA
TGCCACCACTCGTCCGGCTCCTTCTGGTATCCCGACAACCCTTTCATATGGAGGCGATTATTTCAATGTCACGCT
TCCTCAGACCTCGTACAGTGGTTCGGCAAACGATGCTGCAGCTAAGACCAAGGTTGTGCTTACTCGTGGTGGATT
TACGACGCATGCGATGAACATGGGCCAGAGATATCTTCAACTCAATAACACTTACACTGTCCAGGATGATGGTAC
CATTGTATTGCATTGTGCTCAACCACCTCCGAACCCACACATTTTACAACCGGGACCCGTAGTATTCTGGGTGGT
TGTTGATGGTATTCCGAGTAATGGAACAATGGTGATCGTTGGAAATGGCCAGATTGGTCCACAGCCTGTTACAGA
TGCGAGTACTCTACCCGATAGTGTGCTGGCTACGAACAATGTGAATGGTGGCGCGTCGGATTCATCGGGTTCTGG
TGTGGATAACAACAATTCGGACTCGACGACATCCATTGGGGCTATCGTTGGTGGTGTCGTTGGTGGTATAGCGGC
TCTTGCTGCGATTGTCGGTGCAGTAGTATTCTTCATGAGAAGACGTAATGCTGGTGGACGTGGAGTGTATACACA
GAAAGCCGCTCCTGCTTCGACATACGATTTTGGTTCAACTCCTTTGGAGACTACCAGAGGTCATATACCCATCCC
ATCGGATTCTAGTTCGTTCGTGCCCTTAAACCAGGAGAATAGGAGTGTTGCTTGGAATGCTGGAAGTACGGCGAG
TCTGCATGAAGCGGCGGGTGTGAGCGCGCCTTATAGAGACGATCCGAGAACAAGTAGTATGGGAAGTGGGGGAGG
GTATGGCGGATATCCTATGCAGGAACAAAACTATGACCCGTATGCTAGGGCTGGGCCAGGTGGGAGATTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail