Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031830
Gene name
Locationscaffold_12:995805..997890
Strand+
Gene length (bp)2085
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 5.9E-08 20 189
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.2E-06 23 51

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 16 38 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031830
MLGRHIESRKRSSSHVEVLNVSVVGGSIAGMAVAFTLARAGHRVTVFETSDGKNNRCGALKLPPNGTLLLNRWGL
KTKLDICSRKFMRCNFIRSGNDRTVGTLLLNELLQHEAFLSQGIADYTCVKDSQLWDWLYKLAKDSGATCRFNSK
VVKVNATRPSITLESGEEIVADFIVGADSVHGIARSVVSGGSPDTSGDRYLTISCTLPCDEFSADPDLKSLLNES
SLFIWAAEDMQMQGQMNKGADTFTLTLGYKLPPNLVLDPSIKSSTWYDNFKLEDFPFIDEGKFTKRALKLLNLIK
GVKTYVNLYDEPQLLDDLISDSGKVVLIGSAAHGMPPGMQHNTSLGLEDAEALGYLFSRIPSGSLVPRFLMAYEE
IRSTRIAHASQMEVSLLQSWVMPEGPARDQFDTFLAKSAAQDGMMDDEELLVLWSETLNMWLYDAGEKVDDWWSK
WGTGILREYWEPESEPTAIFVDRNISHQ*
Coding >AgabiH97|031830
ATGCTTGGTCGTCATATAGAGTCGAGAAAGAGAAGTTCCTCACATGTTGAAGTTCTGAATGTCTCTGTTGTAGGC
GGAAGCATAGCAGGAATGGCGGTGGCATTCACTTTGGCAAGGGCTGGACATAGGGTTACTGTCTTCGAGACATCC
GATGGGAAGAACAATCGATGCGGGGCGCTCAAACTCCCACCTAATGGCACCCTCCTTCTGAATCGCTGGGGATTG
AAGACGAAGTTGGATATTTGCAGTCGGAAGTTCATGAGATGTAATTTCATTCGGAGCGGGAATGATCGTACAGTC
GGCACCCTTCTCCTCAATGAGCTCCTCCAACACGAAGCTTTCTTGAGCCAAGGTATTGCCGATTACACTTGTGTG
AAGGACTCACAATTATGGGATTGGCTATACAAACTCGCCAAAGATTCTGGAGCAACTTGTAGATTCAATTCTAAA
GTGGTCAAAGTGAATGCGACAAGACCAAGTATCACATTAGAGAGTGGAGAGGAGATCGTGGCCGATTTCATCGTA
GGTGCTGATAGTGTTCACGGGATCGCACGCTCCGTGGTTAGCGGTGGAAGCCCTGATACGAGTGGAGATCGATAC
TTGACTATCTCATGCACATTGCCTTGTGATGAATTTTCTGCGGATCCAGATTTGAAAAGCCTTTTGAATGAATCG
AGTTTGTTTATATGGGCGGCGGAGGATATGCAAATGCAGGGGCAGATGAATAAGGGAGCAGACACATTTACGCTG
ACCTTGGGATACAAGCTTCCTCCGAATTTGGTCCTCGATCCTTCTATCAAGAGCTCTACATGGTATGACAATTTC
AAGTTGGAAGATTTTCCGTTCATCGACGAGGGGAAGTTCACTAAAAGAGCTTTGAAATTGTTGAACTTGATCAAA
GGCGTCAAAACCTACGTTAACCTCTATGATGAGCCTCAGTTGCTTGACGATTTGATTTCTGATTCTGGTAAAGTC
GTTCTGATCGGTAGCGCGGCTCATGGAATGCCGCCTGGCATGCAACACAATACTTCGTTAGGATTGGAGGATGCA
GAGGCTCTGGGATACCTATTCTCGCGTATCCCATCTGGCTCACTCGTCCCGAGATTCCTGATGGCCTACGAAGAA
ATACGGAGTACAAGAATCGCTCACGCTTCTCAAATGGAGGTCTCATTATTACAGTCATGGGTAATGCCAGAAGGA
CCTGCGCGCGATCAATTTGATACATTTTTGGCGAAATCGGCTGCGCAGGACGGGATGATGGATGATGAGGAACTT
TTGGTCCTTTGGAGCGAAACATTGAACATGTGGTTGTATGATGCGGGTGAGAAGGTGGATGACTGGTGGTCCAAG
TGGGGAACTGGCATTTTGAGAGAATATTGGGAGCCTGAAAGTGAACCGACAGCGATTTTTGTAGACAGGAATATT
TCGCATCAGTGA
Transcript >AgabiH97|031830
ATGCTTGGTCGTCATATAGAGTCGAGAAAGAGAAGTTCCTCACATGTTGAAGTTCTGAATGTCTCTGTTGTAGGC
GGAAGCATAGCAGGAATGGCGGTGGCATTCACTTTGGCAAGGGCTGGACATAGGGTTACTGTCTTCGAGACATCC
GATGGGAAGAACAATCGATGCGGGGCGCTCAAACTCCCACCTAATGGCACCCTCCTTCTGAATCGCTGGGGATTG
AAGACGAAGTTGGATATTTGCAGTCGGAAGTTCATGAGATGTAATTTCATTCGGAGCGGGAATGATCGTACAGTC
GGCACCCTTCTCCTCAATGAGCTCCTCCAACACGAAGCTTTCTTGAGCCAAGGTATTGCCGATTACACTTGTGTG
AAGGACTCACAATTATGGGATTGGCTATACAAACTCGCCAAAGATTCTGGAGCAACTTGTAGATTCAATTCTAAA
GTGGTCAAAGTGAATGCGACAAGACCAAGTATCACATTAGAGAGTGGAGAGGAGATCGTGGCCGATTTCATCGTA
GGTGCTGATAGTGTTCACGGGATCGCACGCTCCGTGGTTAGCGGTGGAAGCCCTGATACGAGTGGAGATCGATAC
TTGACTATCTCATGCACATTGCCTTGTGATGAATTTTCTGCGGATCCAGATTTGAAAAGCCTTTTGAATGAATCG
AGTTTGTTTATATGGGCGGCGGAGGATATGCAAATGCAGGGGCAGATGAATAAGGGAGCAGACACATTTACGCTG
ACCTTGGGATACAAGCTTCCTCCGAATTTGGTCCTCGATCCTTCTATCAAGAGCTCTACATGGTATGACAATTTC
AAGTTGGAAGATTTTCCGTTCATCGACGAGGGGAAGTTCACTAAAAGAGCTTTGAAATTGTTGAACTTGATCAAA
GGCGTCAAAACCTACGTTAACCTCTATGATGAGCCTCAGTTGCTTGACGATTTGATTTCTGATTCTGGTAAAGTC
GTTCTGATCGGTAGCGCGGCTCATGGAATGCCGCCTGGCATGCAACACAATACTTCGTTAGGATTGGAGGATGCA
GAGGCTCTGGGATACCTATTCTCGCGTATCCCATCTGGCTCACTCGTCCCGAGATTCCTGATGGCCTACGAAGAA
ATACGGAGTACAAGAATCGCTCACGCTTCTCAAATGGAGGTCTCATTATTACAGTCATGGGTAATGCCAGAAGGA
CCTGCGCGCGATCAATTTGATACATTTTTGGCGAAATCGGCTGCGCAGGACGGGATGATGGATGATGAGGAACTT
TTGGTCCTTTGGAGCGAAACATTGAACATGTGGTTGTATGATGCGGGTGAGAAGGTGGATGACTGGTGGTCCAAG
TGGGGAACTGGCATTTTGAGAGAATATTGGGAGCCTGAAAGTGAACCGACAGCGATTTTTGTAGACAGGAATATT
TCGCATCAGTGA
Gene >AgabiH97|031830
ATGCTTGGTCGTCATATAGAGTCGAGAAAGAGAAGTTCCTCACATGTTGAAGTTCTGAATGTCTCTGTTGTAGGC
GGAAGCATAGCAGGTGAGTGTTTTTCAAGAGTCTGATATCCTATCCCAAAACTAAGGTGACTGGGCTGATTTCGT
GTGGATACTTAGGAATGGCGGTGGCATTCACTTTGGCAAGGGCTGGACATAGGGTTACTGTCTTCGAGACATCCG
ATGGGAAGAACAATGTGAGTAACATCAGAAAAGCGATTGATCGTCCTCCCTATGTCTACTCGTTGTACGGTTATC
GTTTACTAACGTGTTGATTGATTGGTTTTCTATATTTAGCGATGCGGGGCGCTCAAGTAAGTCTCGTAGCAGGGG
GTTGTTCGGATTGCACGCACACCGGTTTAAACCCGCTCTAACAGACTCCCACCTAATGGCACCCTCCTTCTGAAT
CGCTGGGGATTGAAGACGAAGTTGGATATTTGCAGTCGGAAGTTCATGAGATGTAATTTCATTCGGAGTAAGTAT
CTGCGCGACTTCATTTTGTCGAGAACGTTGACAAAATGTCTGTCTCTTTTTTTTTCGCTTATTTTAGGCGGGAAT
GATCGTACAGTCGGCACCCTTCTCCTCAATGAGCTCCTCCAACACGAAGCTTTCTTGAGCCAAGGTATTGCCGAT
TACACTTGTGTGAAGGTATGTAAACATGTACACATGTATAGTGCTTCTTTAATGGTCTTGGCAATGCTCAATTTG
TGCGTGTGTGCGTGCCGTGCTTCTTCGCCCTCCATTTCTCTAGGACTCACAATTATGGGATTGGCTATACAAACT
CGCCAAAGATTCTGGAGCAACTTGTAGATTCAATTCTAAAGTGGTCAAAGTGAATGCGACAAGACCAAGTATCAC
ATTAGAGAGTGGAGAGGAGATCGTGGCCGATTTCATCGTAGGTGCTGATAGTGTTCACGGGATCGCACGCTCCGT
GGTTAGCGGTGGAAGCCCTGATACGAGTGGAGATCGATACTTGACTATCTCATGCACATTGCCTTGTGATGAATT
TTCTGCGGATCCAGATTTGAAAAGCCTTTTGAATGAATCGAGTGTATGTCATCTTTTTCTCTATCGTTCGCTGGA
AACCGCTGATTACATCTTTTATTTGTTAGTTGTTTATATGGGCGGCGGAGGATATGCAAATGCAGGGGCAGATGA
ATGTCAGTTCTAATCATTTGCGAAGTGAATGTTTGGATTGGCTGATCCCGATGACGTAGAAGGGAGCAGACACAT
TTACGCTGACCTTGGGATACAAGCTTCCTCCGAATTTGGTCCTCGATCCTTCTATCAAGAGCTCTACATGGTATG
ACAATTTCAAGTTGGAAGATTTTCCGTTCATCGACGAGGGGAAGTTCACTAAAAGGTAACCACCCCGATTCAGAT
TTTTTCCTTTTCTCTGAACATGGTTTCTCAGAGCTTTGAAATTGTTGAACTTGATCAAAGGCGTCAAAACCTACG
TTAACCTCTATGATGAGCCTCAGTTGCTTGACGATTTGATTTCTGATTCTGGTAAAGTCGTTCTGATCGGTAGCG
CGGCTCATGGAATGCCGGTGAGTCCGGGATACATGATTCGAATTGCCAGGTGTTAATTTTTGGGTTTTTTTTTCG
CCTCAGCCTGGCATGCAACACAATACTTCGTTAGGATTGGAGGATGCAGAGGCTCTGGGATACCTATTCTCGCGT
ATCCCATCTGGCTCACTCGTCCCGAGATTCCTGATGGCCTACGAAGAAATACGGAGTACAAGAATCGCTCACGCT
TCTCAAATGGAGGTCTCATTATTACAGTCATGGGTAATGCCAGAAGGACCTGCGCGCGATCAATTTGATACATTT
TTGGCGAAATCGGCTGCGCAGGACGGGATGATGGATGATGAGGAACTTTTGGTCCTTTGGAGCGAAACATTGAAC
ATGTGGTTGTATGATGCGGGTGAGAAGGTGGATGACTGGTGGTCCAAGTGGGGAACTGGCATTTTGAGAGAATAT
TGGGAGCCTGAAAGTGAACCGACAGCGATTTTTGTAGACAGGAATATTTCGCATCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail