Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031820
Gene name
Locationscaffold_12:989530..991518
Strand+
Gene length (bp)1988
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.5E-23 67 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 17 424 3.0E-40
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 18 423 8.0E-37
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 13 394 2.0E-19
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 31 421 3.0E-17
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 31 418 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 17 424 3.0E-40
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 18 423 8.0E-37
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 13 394 2.0E-19
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 31 421 3.0E-17
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 31 418 5.0E-17
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 33 421 8.0E-17
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 33 421 2.0E-16
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 11 363 3.0E-16
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 23 396 9.0E-13
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 15 394 1.0E-12
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 8 394 4.0E-12
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 24 427 9.0E-12
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 6 394 1.0E-11
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 24 417 2.0E-11
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 24 417 3.0E-11
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 24 396 3.0E-11
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 8 394 5.0E-11
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 36 430 8.0E-11
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 36 432 2.0E-10
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 9 394 2.0E-09
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 36 416 4.0E-09
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 36 394 2.0E-08
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 9 314 3.0E-08
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 48 219 3.0E-07
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 20 433 1.0E-06
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 27 304 1.0E-06
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 27 304 2.0E-06
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 33 235 3.0E-06
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 33 183 3.0E-06
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 31 396 4.0E-06
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 27 304 7.0E-06
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 27 304 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 82 99 17
3 106 128 22
4 138 160 22
5 167 189 22
6 199 221 22
7 246 268 22
8 283 300 17
9 312 329 17
10 339 361 22
11 373 395 22
12 405 427 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031820
MTTRSSTPSPLDKEKFHHDDAHQDSPPPPITFPEGGTRAWLTVLGGSISVFCTFGVVQSFGVYQDYYTRVLLSEH
SPSEISWIGSVQVFLVFAVGLPAGKLFDLGYFHHLLIIGSLLYLFSSFMLSLAQPHSYYQVFLAQSIGEGLGMGL
LFIPSLAVSSHYFRKKRSLAMGLIIAGASLGGCLYPIMLNNIFQNAGFGWGVRAVSFLDFGLLILANLIMRTRLP
PNRKKGNNLPLLKELLTDVPFLVYGAGSFLAFWGAFIPFFYLQLFASLHNLDKTFTKYSLTIMNATSIFGRIVPN
LIADKYGPMNTLIVSSFVTGGLVFALFGATNEGGAAAFGIFYGFFSGGTISLITPALTSFITHNDGSDLPLRIAL
LSFLLSLPLLTGNPLAGALLSPPHYLWFRPIILASMFLLAGSGCFVVTWTLLHKRKNTAII*
Coding >AgabiH97|031820
ATGACGACTCGCTCCTCCACCCCGTCCCCCCTCGACAAGGAAAAGTTCCACCACGACGACGCTCACCAGGACTCT
CCTCCTCCTCCAATCACTTTTCCTGAAGGCGGCACCAGGGCATGGCTCACCGTTCTCGGCGGCTCCATCTCCGTC
TTTTGCACCTTTGGCGTCGTCCAGTCGTTCGGTGTCTACCAAGATTATTACACACGCGTTTTACTCAGCGAACAC
TCACCCTCTGAAATTAGCTGGATAGGCTCCGTCCAAGTCTTTCTCGTCTTTGCCGTCGGCCTTCCCGCCGGCAAA
TTATTCGATCTCGGATATTTTCACCATCTGTTGATCATCGGCTCATTGCTCTACCTCTTCTCGTCTTTCATGCTC
TCTCTCGCGCAACCTCATAGCTACTATCAAGTCTTCCTCGCACAGAGTATCGGCGAGGGACTGGGAATGGGTCTC
TTGTTCATTCCTAGTCTCGCCGTCTCCTCTCACTATTTCCGCAAAAAAAGATCACTGGCAATGGGTCTCATCATA
GCTGGAGCCAGCCTCGGAGGCTGTCTATACCCCATCATGCTCAATAATATATTTCAAAACGCCGGATTCGGTTGG
GGCGTCCGAGCCGTTTCCTTTCTTGACTTTGGACTATTAATCTTGGCTAATCTCATCATGCGAACAAGGCTCCCG
CCCAATCGGAAAAAGGGCAACAACCTCCCTCTACTCAAGGAGCTTTTGACCGATGTCCCATTCCTCGTGTACGGC
GCTGGATCATTCCTTGCATTCTGGGGCGCCTTTATTCCCTTTTTCTACTTGCAGCTCTTTGCATCTTTGCACAAT
CTAGACAAAACTTTTACAAAATACTCTCTTACCATCATGAACGCAACCTCTATCTTTGGTCGCATAGTGCCGAAC
CTCATTGCGGACAAATACGGACCCATGAACACCCTGATTGTCTCGTCCTTCGTCACCGGTGGCCTCGTGTTTGCT
TTATTCGGCGCAACAAACGAAGGTGGTGCTGCCGCCTTTGGGATCTTCTATGGCTTCTTTTCAGGCGGAACAATC
TCTTTGATTACTCCAGCGTTGACCAGTTTCATCACGCATAATGATGGTTCAGACTTACCATTACGCATAGCGCTT
CTGTCATTTCTGCTGTCATTGCCGTTGTTGACGGGTAATCCACTTGCCGGTGCCTTGTTGTCGCCGCCGCATTAT
TTGTGGTTTAGACCTATCATTTTGGCTTCGATGTTTTTGCTTGCGGGTTCGGGATGTTTTGTCGTCACATGGACG
TTACTCCACAAGCGTAAAAACACCGCCATCATTTGA
Transcript >AgabiH97|031820
ATGACGACTCGCTCCTCCACCCCGTCCCCCCTCGACAAGGAAAAGTTCCACCACGACGACGCTCACCAGGACTCT
CCTCCTCCTCCAATCACTTTTCCTGAAGGCGGCACCAGGGCATGGCTCACCGTTCTCGGCGGCTCCATCTCCGTC
TTTTGCACCTTTGGCGTCGTCCAGTCGTTCGGTGTCTACCAAGATTATTACACACGCGTTTTACTCAGCGAACAC
TCACCCTCTGAAATTAGCTGGATAGGCTCCGTCCAAGTCTTTCTCGTCTTTGCCGTCGGCCTTCCCGCCGGCAAA
TTATTCGATCTCGGATATTTTCACCATCTGTTGATCATCGGCTCATTGCTCTACCTCTTCTCGTCTTTCATGCTC
TCTCTCGCGCAACCTCATAGCTACTATCAAGTCTTCCTCGCACAGAGTATCGGCGAGGGACTGGGAATGGGTCTC
TTGTTCATTCCTAGTCTCGCCGTCTCCTCTCACTATTTCCGCAAAAAAAGATCACTGGCAATGGGTCTCATCATA
GCTGGAGCCAGCCTCGGAGGCTGTCTATACCCCATCATGCTCAATAATATATTTCAAAACGCCGGATTCGGTTGG
GGCGTCCGAGCCGTTTCCTTTCTTGACTTTGGACTATTAATCTTGGCTAATCTCATCATGCGAACAAGGCTCCCG
CCCAATCGGAAAAAGGGCAACAACCTCCCTCTACTCAAGGAGCTTTTGACCGATGTCCCATTCCTCGTGTACGGC
GCTGGATCATTCCTTGCATTCTGGGGCGCCTTTATTCCCTTTTTCTACTTGCAGCTCTTTGCATCTTTGCACAAT
CTAGACAAAACTTTTACAAAATACTCTCTTACCATCATGAACGCAACCTCTATCTTTGGTCGCATAGTGCCGAAC
CTCATTGCGGACAAATACGGACCCATGAACACCCTGATTGTCTCGTCCTTCGTCACCGGTGGCCTCGTGTTTGCT
TTATTCGGCGCAACAAACGAAGGTGGTGCTGCCGCCTTTGGGATCTTCTATGGCTTCTTTTCAGGCGGAACAATC
TCTTTGATTACTCCAGCGTTGACCAGTTTCATCACGCATAATGATGGTTCAGACTTACCATTACGCATAGCGCTT
CTGTCATTTCTGCTGTCATTGCCGTTGTTGACGGGTAATCCACTTGCCGGTGCCTTGTTGTCGCCGCCGCATTAT
TTGTGGTTTAGACCTATCATTTTGGCTTCGATGTTTTTGCTTGCGGGTTCGGGATGTTTTGTCGTCACATGGACG
TTACTCCACAAGCGTAAAAACACCGCCATCATTTGA
Gene >AgabiH97|031820
ATGACGACTCGCTCCTCCACCCCGTCCCCCCTCGACAAGGAAAAGTTCCACCACGACGACGCTCACCAGGACTCT
CCTCCTCCTCCAATCACTTTTCCTGAAGGCGGCACCAGGGCATGGCTCACCGTTCTCGGCGGGTGAGCTCTCTTC
TAGTTTTCTACGTTCTTTTCATTCATCACCCCCCAGCTCCATCTCCGTCTTTTGCACCTTTGGCGTCGTCCAGTC
GTTCGGTGTCTACCAAGATTATTACACAGTTGGTTACATCACCTTATCCACCGACATTAAACTCAACTCTATCAG
CGCGTTTTACTCAGCGAACACTCACCCTCTGAAATTAGCTGGATAGGCTCCGTCCAAGTCTTTCTCGTCTTTGCC
GTCGGCCTTCCCGCCGGCAAATTATTCGATCTCGGATATTTTCACCATCTGTTGATCATCGGCTCATTGCTCTAC
CTCTTCTCGTATGTTGCCGTTCCATATCTTCTCTCACTCCTTGGCCAACGTACAGCAGGTCTTTCATGCTCTCTC
TCGCGCAACCTCATAGCTACTATCAAGTCTTCCTCGCACAGAGTATCGGCGAGGGACTGGGAATGGGTCTCTTGT
TCATTCCTAGTCTCGCCGTCTCCTCTCACTATTTCCGCAAAAAAAGATCACTGGCAATGGGTCTCATCATAGCTG
GTTCGACCGCTTTCTTTCAATCTAGTGCTGAACTCAGTCTTCTCTCCAGGAGCCAGCCTCGGAGGCTGTCTATAC
CCCATCATGCTCAATAATATATTTCAAAACGCCGGATTCGGTTGGGGCGTCCGGTACGTCTTTAACCTCGCTATC
CACATACCTCCGTCAACTCATTTTCACTCCACAGAGCCGTTTCCTTTCTTGACTTTGGACTATTAATCTTGGCTA
ATCTCATCATGCGAACAAGGCTCCCGCCCAATCGGAAAAAGGGCAACAACCTCCCTCTACTCAAGGAGCTTTTGA
CCGATGTCCCATTCCTCGTGTACGGCGCTGGATCATTCCTTGTTCGTTTCACCACTCTCGTACTCAATGTCTTTC
TAACTTGGAACACAGGCATTCTGGGGCGCCTTTATTCCCTGTCAGATTCTTTCCTTACCCTCCTTGCTTCATCTG
ACCGGTATTTTCAGTTTTCTACTTGCAGCTCTTTGCATCTTTGCACAATCTAGACAAAACTTTTACAAAATACTC
TGTAAGGCATTCGTATCTGCTTCCAAACCCTCGTTTCTGACTCGACGCAGCTTACCATCATGAACGCAACCTCTA
TCTTTGGTCGCATAGTGCCGAACCTCATTGCGGACAAATACGGACCCATGAACAGTAAGCCTTCCCGATGGCCAA
CGTGATATATTACCCACGTCAATGCTTCCGTGCTCTATAGCCCTGATTGTCTCGTCCTTCGTCACCGGTGGCCTC
GTGTTTGCTTTATTCGGCGCAACAAACGAAGGTGGTGCTGCCGCCTTTGGGATCTTCTATGGCTTCTTTTCAGGC
GGAAGTGAGTTTCTTTATACTTAGTATCGCAGTAACCTTGCTGACTCTTTTTCCTTTGACAACAGCAATCTCTTT
GATTACTCCAGCGTTGACCAGTTTCATCACGCATAATGATGGTTCAGACTTACCGTATGCAACACTTTTCGTTTC
ATGTTATTTTTAACATGATCATGCGGTTCTTTCTTACATCTTCTTGACTTCTATTTTTTTTTGCAGATTACGCAT
AGCGCTTCTGTCATTTCTGCTGTCATTGCCGTTGTTGACGGGTAATCCACTTGCCGGTGCCTTGTTGTCGCCGCC
GCATTATTTGTGGTTTAGACCTATCATTTTGGCTTCGGTACGGGTTGCAGTCATTTTGCGAAATCACGTTCATTT
GATTGAGGTTGTTGACTTGGTTGTTTGTGTAGATGTTTTTGCTTGCGGGTTCGGGATGTTTTGTCGTCACATGGA
CGTTACTCCACAAGCGTAAAAACACCGCCATCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail