Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031640
Gene name
Locationscaffold_12:946798..947591
Strand-
Gene length (bp)793
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 1.2E-07 15 41
PF00036 EF-hand_1 EF hand 4.5E-06 49 76
PF00036 EF-hand_1 EF hand 1.1E-08 85 113
PF00036 EF-hand_1 EF hand 7.8E-08 121 147
PF13499 EF-hand_7 EF-hand domain pair 2.3E-15 15 74
PF13499 EF-hand_7 EF-hand domain pair 3.6E-16 84 146
PF13405 EF-hand_6 EF-hand domain 3.4E-06 15 41
PF13405 EF-hand_6 EF-hand domain 2.9E-07 85 112
PF13202 EF-hand_5 EF hand 4.3E-08 16 38
PF13202 EF-hand_5 EF hand 8.4E-03 57 72
PF13202 EF-hand_5 EF hand 6.8E-04 89 107
PF13202 EF-hand_5 EF hand 4.5E-05 126 145
PF13833 EF-hand_8 EF-hand domain pair 1.1E-02 18 38
PF13833 EF-hand_8 EF-hand domain pair 3.2E-08 27 74
PF13833 EF-hand_8 EF-hand domain pair 5.5E-03 82 105
PF13833 EF-hand_8 EF-hand domain pair 9.5E-10 104 143
PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand 4.4E-07 5 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 5 148 2.0E-38
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 6 146 5.0E-38
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 6 146 5.0E-38
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 6 146 5.0E-38
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 6 148 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 5 148 2.0E-38
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 6 146 5.0E-38
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 6 146 5.0E-38
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 6 146 5.0E-38
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 6 148 5.0E-38
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 6 146 3.0E-37
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 6 146 3.0E-37
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 6 146 3.0E-37
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 6 146 3.0E-37
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 5 148 4.0E-37
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 5 148 5.0E-37
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 5 148 5.0E-37
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 5 148 6.0E-37
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 5 148 9.0E-37
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 5 146 1.0E-36
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 5 146 1.0E-36
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 5 146 1.0E-36
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 5 146 1.0E-36
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 5 148 1.0E-36
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 5 146 1.0E-36
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 5 148 1.0E-36
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 5 148 1.0E-36
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 5 148 1.0E-36
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 5 148 1.0E-36
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 5 148 1.0E-36
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 5 148 1.0E-36
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 6 148 1.0E-36
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 5 148 2.0E-36
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 5 148 2.0E-36
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 5 148 2.0E-36
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 5 148 2.0E-36
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 5 148 2.0E-36
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 5 148 2.0E-36
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 5 148 2.0E-36
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 5 148 2.0E-36
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 5 148 2.0E-36
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 5 148 2.0E-36
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 5 148 2.0E-36
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 5 148 2.0E-36
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 5 148 2.0E-36
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 5 148 2.0E-36
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 5 148 2.0E-36
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 5 148 2.0E-36
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 1 146 2.0E-36
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 5 146 2.0E-36
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 6 148 2.0E-36
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 5 148 2.0E-36
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 5 146 2.0E-36
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 5 148 2.0E-36
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 5 148 2.0E-36
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 5 148 2.0E-36
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 5 148 2.0E-36
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 5 148 2.0E-36
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 5 148 2.0E-36
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 5 148 2.0E-36
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 5 146 2.0E-36
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 1 148 2.0E-36
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 5 148 2.0E-36
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 5 146 2.0E-36
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 5 146 2.0E-36
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 5 146 3.0E-36
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 5 146 3.0E-36
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 5 146 3.0E-36
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 5 148 4.0E-36
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 5 146 4.0E-36
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 5 146 4.0E-36
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 5 146 4.0E-36
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 5 146 4.0E-36
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 5 146 4.0E-36
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 5 146 4.0E-36
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 5 146 4.0E-36
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 5 146 4.0E-36
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 5 146 4.0E-36
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 5 146 4.0E-36
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 5 148 4.0E-36
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 5 148 5.0E-36
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 6 148 5.0E-36
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 5 148 5.0E-36
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 5 148 5.0E-36
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 5 148 5.0E-36
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 5 148 7.0E-36
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 5 146 7.0E-36
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 5 146 8.0E-36
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 5 148 8.0E-36
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 5 148 9.0E-36
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 5 148 9.0E-36
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 5 142 9.0E-36
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 5 146 9.0E-36
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 5 146 1.0E-35
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 5 146 1.0E-35
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 5 146 1.0E-35
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 5 146 1.0E-35
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 5 148 1.0E-35
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 5 146 1.0E-35
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 6 146 1.0E-35
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 5 146 1.0E-35
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 5 147 2.0E-35
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 5 146 2.0E-35
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 5 148 2.0E-35
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 5 148 2.0E-35
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 5 146 2.0E-35
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 5 148 2.0E-35
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 5 147 2.0E-35
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 5 146 2.0E-35
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 5 146 3.0E-35
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 5 146 3.0E-35
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 5 146 3.0E-35
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 5 146 3.0E-35
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 5 148 3.0E-35
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 5 146 5.0E-35
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 5 146 5.0E-35
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 5 146 1.0E-34
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 5 148 2.0E-34
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 9 142 2.0E-34
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 5 146 3.0E-34
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 5 146 3.0E-34
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 5 146 3.0E-34
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 5 146 4.0E-34
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 5 146 6.0E-34
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 5 146 2.0E-33
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 14 148 2.0E-33
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 5 148 3.0E-33
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 6 146 4.0E-33
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 14 142 5.0E-33
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 6 146 6.0E-33
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 5 148 5.0E-32
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 5 148 5.0E-32
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 5 148 3.0E-31
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 5 147 2.0E-30
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 4 146 2.0E-30
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 5 147 3.0E-30
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 6 146 3.0E-30
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 6 142 3.0E-30
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 6 146 1.0E-29
sp|P30187|CML10_ARATH Calmodulin-like protein 10 OS=Arabidopsis thaliana GN=CML10 PE=2 SV=1 5 146 2.0E-29
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 6 146 1.0E-28
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 6 148 2.0E-28
sp|Q6L5F4|CML14_ORYSJ Probable calcium-binding protein CML14 OS=Oryza sativa subsp. japonica GN=CML14 PE=2 SV=1 3 147 3.0E-28
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 6 146 3.0E-28
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 6 148 4.0E-28
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 6 146 4.0E-28
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 6 146 4.0E-28
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 6 148 4.0E-28
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 6 148 5.0E-28
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 6 146 9.0E-28
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 6 146 1.0E-27
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 6 148 3.0E-27
sp|Q3SB13|CALGL_PSETE Calglandulin OS=Pseudonaja textilis PE=2 SV=1 6 148 9.0E-27
sp|Q3SB08|CALGL_PSEPO Calglandulin OS=Pseudechis porphyriacus PE=2 SV=1 6 148 9.0E-27
sp|Q3SB09|CALGL_PSEAU Calglandulin OS=Pseudechis australis PE=2 SV=1 6 148 9.0E-27
sp|Q3SB15|CALGL_OXYSC Calglandulin OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 6 148 9.0E-27
sp|Q3SB14|CALGL_OXYMI Calglandulin OS=Oxyuranus microlepidotus PE=2 SV=1 6 148 9.0E-27
sp|Q3SB12|CALGL_NOTSC Calglandulin OS=Notechis scutatus scutatus PE=2 SV=1 6 148 9.0E-27
sp|Q3SB10|CALGL_HOPST Calglandulin OS=Hoplocephalus stephensii PE=2 SV=1 6 148 9.0E-27
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 6 148 2.0E-26
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 6 148 3.0E-26
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 6 148 3.0E-26
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 27 146 3.0E-26
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 14 147 3.0E-26
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 6 147 1.0E-25
sp|Q9M8U1|CML18_ARATH Probable calcium-binding protein CML18 OS=Arabidopsis thaliana GN=CML18 PE=1 SV=1 3 148 6.0E-25
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 5 148 1.0E-24
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 1 146 2.0E-24
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 6 147 3.0E-24
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 6 145 3.0E-24
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 8 147 4.0E-24
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 6 146 6.0E-24
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 18 148 2.0E-23
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 1 146 2.0E-23
sp|Q8TD86|CALL6_HUMAN Calmodulin-like protein 6 OS=Homo sapiens GN=CALML6 PE=2 SV=2 5 148 2.0E-23
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 1 146 2.0E-23
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 6 146 2.0E-23
sp|Q5ZD81|CML12_ORYSJ Probable calcium-binding protein CML12 OS=Oryza sativa subsp. japonica GN=CML12 PE=2 SV=1 5 147 4.0E-23
sp|O00897|CALML_DICDI Calmodulin-like protein OS=Dictyostelium discoideum GN=calB PE=2 SV=1 14 148 4.0E-23
sp|Q84VG0|CML7_ORYSJ Probable calcium-binding protein CML7 OS=Oryza sativa subsp. japonica GN=CML7 PE=2 SV=1 5 147 4.0E-23
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 5 148 5.0E-23
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 5 148 6.0E-23
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 6 146 7.0E-23
sp|Q94AZ4|CML13_ARATH Probable calcium-binding protein CML13 OS=Arabidopsis thaliana GN=CML13 PE=2 SV=1 6 142 8.0E-23
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 27 146 1.0E-22
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 6 148 1.0E-22
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 6 148 1.0E-22
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 5 148 2.0E-22
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 5 148 2.0E-22
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 15 146 2.0E-22
sp|Q9AWK2|CML11_ORYSJ Probable calcium-binding protein CML11 OS=Oryza sativa subsp. japonica GN=CML11 PE=2 SV=1 6 148 2.0E-22
sp|Q8VZ50|CML14_ARATH Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1 6 142 2.0E-22
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 5 148 3.0E-22
sp|Q9LI84|CML16_ARATH Probable calcium-binding protein CML16 OS=Arabidopsis thaliana GN=CML16 PE=2 SV=2 9 147 3.0E-22
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 5 148 6.0E-22
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 5 148 6.0E-22
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 5 148 7.0E-22
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 3 148 8.0E-22
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 18 146 1.0E-21
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 18 147 2.0E-21
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 18 146 2.0E-21
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 2 146 3.0E-21
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 15 147 6.0E-21
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 3 146 7.0E-21
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 18 148 1.0E-20
sp|Q9C9U8|CML26_ARATH Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1 18 148 1.0E-20
sp|P04110|SPE2A_STRPU Calcium-binding protein SPEC 2A OS=Strongylocentrotus purpuratus GN=SPEC2A PE=2 SV=2 6 148 2.0E-20
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 4 146 3.0E-20
sp|P04111|SPE2C_STRPU Calcium-binding protein SPEC 2C OS=Strongylocentrotus purpuratus GN=SPEC2C PE=2 SV=2 6 148 3.0E-20
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 6 148 3.0E-20
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 6 148 5.0E-20
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 15 147 5.0E-20
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 18 147 7.0E-20
sp|P15845|SM20_SCHMA 20 kDa calcium-binding protein OS=Schistosoma mansoni GN=SM20 PE=2 SV=2 6 148 1.0E-19
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 18 142 2.0E-19
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 6 147 3.0E-19
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 6 147 3.0E-19
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 6 147 3.0E-19
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 15 146 4.0E-19
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 6 147 6.0E-19
sp|Q9BLG0|TNNC_TODPA Troponin C OS=Todarodes pacificus PE=1 SV=3 3 146 6.0E-19
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 18 148 7.0E-19
sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 6 148 7.0E-19
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 6 147 1.0E-18
sp|P57796|CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 5 147 2.0E-18
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 6 147 3.0E-18
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 6 146 7.0E-18
sp|Q8HZJ4|CABP4_BOVIN Calcium-binding protein 4 OS=Bos taurus GN=CABP4 PE=2 SV=1 5 147 1.0E-17
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 6 147 1.0E-17
sp|Q8VHC5|CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus GN=Cabp4 PE=1 SV=1 17 148 1.0E-17
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 6 147 1.0E-17
sp|P08053|MLR_PHYPO Myosin regulatory light chain OS=Physarum polycephalum PE=1 SV=1 7 146 3.0E-17
sp|Q5XGC7|CALL4_XENTR Calmodulin-like protein 4 OS=Xenopus tropicalis GN=calml4 PE=2 SV=1 6 147 3.0E-17
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 5 147 4.0E-17
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 1 147 4.0E-17
sp|P14649|MYL6B_HUMAN Myosin light chain 6B OS=Homo sapiens GN=MYL6B PE=1 SV=1 4 147 6.0E-17
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 1 147 6.0E-17
sp|P06706|TNNC_HALRO Troponin C, body wall muscle OS=Halocynthia roretzi PE=1 SV=2 6 142 7.0E-17
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 5 142 9.0E-17
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 18 146 1.0E-16
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 5 146 1.0E-16
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 6 147 1.0E-16
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 6 147 1.0E-16
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 6 148 1.0E-16
sp|P82159|MLE1_LIZRA Myosin light chain 1, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 4 147 2.0E-16
sp|Q5R844|MYL6_PONAB Myosin light polypeptide 6 OS=Pongo abelii GN=MYL6 PE=2 SV=3 6 148 2.0E-16
sp|P60662|MYL6_PIG Myosin light polypeptide 6 OS=Sus scrofa GN=MYL6 PE=1 SV=2 6 148 2.0E-16
sp|Q60605|MYL6_MOUSE Myosin light polypeptide 6 OS=Mus musculus GN=Myl6 PE=1 SV=3 6 148 2.0E-16
sp|P60660|MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 6 148 2.0E-16
sp|P60661|MYL6_BOVIN Myosin light polypeptide 6 OS=Bos taurus GN=MYL6 PE=2 SV=2 6 148 2.0E-16
sp|P29290|TNNCA_HOMAM Troponin C, isoform 2A OS=Homarus americanus PE=1 SV=1 6 148 3.0E-16
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 18 148 3.0E-16
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 6 148 3.0E-16
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 5 146 4.0E-16
sp|Q3T0E8|CALL4_BOVIN Calmodulin-like protein 4 OS=Bos taurus GN=CALML4 PE=2 SV=1 6 147 4.0E-16
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 6 147 4.0E-16
sp|P04109|SPE1A_STRPU Calcium-binding protein SPEC 1A OS=Strongylocentrotus purpuratus GN=SPEC1 PE=2 SV=3 6 148 4.0E-16
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 18 148 5.0E-16
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 6 147 5.0E-16
sp|Q64119|MYL6_RAT Myosin light polypeptide 6 OS=Rattus norvegicus GN=Myl6 PE=1 SV=3 6 146 5.0E-16
sp|P21797|TNNC1_BALNU Troponin C, isoform 1 OS=Balanus nubilus PE=1 SV=1 6 148 6.0E-16
sp|P09485|LPS1A_LYTPI Calcium-binding protein LPS1-alpha OS=Lytechinus pictus PE=2 SV=2 6 142 7.0E-16
sp|Q0DZP5|CML17_ORYSJ Probable calcium-binding protein CML17 OS=Oryza sativa subsp. japonica GN=CML17 PE=2 SV=1 9 148 9.0E-16
sp|P54357|MLC2_DROME Myosin-2 essential light chain OS=Drosophila melanogaster GN=Mlc-c PE=1 SV=1 7 148 1.0E-15
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 18 148 1.0E-15
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 6 142 1.0E-15
sp|P29291|TNNCB_HOMAM Troponin C, isoform 2B OS=Homarus americanus PE=1 SV=1 9 148 1.0E-15
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 6 142 1.0E-15
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CNB1 PE=3 SV=1 1 148 1.0E-15
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 6 142 2.0E-15
sp|P06707|TNNC1_ASTLP Troponin C, isotype alpha OS=Astacus leptodactylus PE=1 SV=1 6 148 2.0E-15
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 6 147 2.0E-15
sp|Q8L3R2|CML41_ARATH Probable calcium-binding protein CML41 OS=Arabidopsis thaliana GN=CML41 PE=2 SV=2 15 147 3.0E-15
sp|P02607|MYL6_CHICK Myosin light polypeptide 6 OS=Gallus gallus GN=MYL6 PE=1 SV=3 6 148 3.0E-15
sp|O74435|CDC31_SCHPO Cell division control protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc31 PE=1 SV=1 4 146 3.0E-15
sp|Q5RBA4|MYL9_PONAB Myosin regulatory light polypeptide 9 OS=Pongo abelii GN=MYL9 PE=2 SV=3 8 146 3.0E-15
sp|P29269|MYL9_PIG Myosin regulatory light polypeptide 9 OS=Sus scrofa GN=MYL9 PE=1 SV=2 8 146 3.0E-15
sp|P24844|MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens GN=MYL9 PE=1 SV=4 8 146 3.0E-15
sp|A4IF97|ML12B_BOVIN Myosin regulatory light chain 12B OS=Bos taurus GN=MYL12B PE=2 SV=1 8 146 3.0E-15
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 6 142 4.0E-15
sp|Q66H96|CABP7_RAT Calcium-binding protein 7 OS=Rattus norvegicus GN=Cabp7 PE=1 SV=1 3 75 4.0E-15
sp|Q866X0|CABP7_PAPAN Calcium-binding protein 7 OS=Papio anubis GN=CABP7 PE=3 SV=1 3 75 4.0E-15
sp|Q91ZM8|CABP7_MOUSE Calcium-binding protein 7 OS=Mus musculus GN=Cabp7 PE=2 SV=1 3 75 4.0E-15
sp|Q86V35|CABP7_HUMAN Calcium-binding protein 7 OS=Homo sapiens GN=CABP7 PE=1 SV=1 3 75 4.0E-15
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 4 146 4.0E-15
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 6 142 4.0E-15
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 12 148 4.0E-15
sp|Q91WQ9|CALL4_MOUSE Calmodulin-like protein 4 OS=Mus musculus GN=Calml4 PE=1 SV=2 6 142 5.0E-15
sp|P09485|LPS1A_LYTPI Calcium-binding protein LPS1-alpha OS=Lytechinus pictus PE=2 SV=2 1 148 6.0E-15
sp|P06708|TNNC2_ASTLP Troponin C, isotype gamma OS=Astacus leptodactylus PE=1 SV=1 6 148 6.0E-15
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 6 148 6.0E-15
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 6 142 6.0E-15
sp|P02612|MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus PE=1 SV=2 8 146 6.0E-15
sp|Q9SRR7|CML3_ARATH Calmodulin-like protein 3 OS=Arabidopsis thaliana GN=CML3 PE=2 SV=1 18 148 7.0E-15
sp|Q9CQ19|MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus GN=Myl9 PE=1 SV=3 8 146 7.0E-15
sp|Q5RC34|ML12A_PONAB Myosin regulatory light chain 12A OS=Pongo abelii GN=MYL12A PE=2 SV=3 8 146 8.0E-15
sp|P19105|ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens GN=MYL12A PE=1 SV=2 8 146 8.0E-15
sp|Q5E9E2|MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus GN=MYL9 PE=2 SV=3 8 146 1.0E-14
sp|Q3THE2|ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus GN=Myl12b PE=1 SV=2 8 146 1.0E-14
sp|O14950|ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens GN=MYL12B PE=1 SV=2 8 146 1.0E-14
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 11 142 1.0E-14
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 6 142 1.0E-14
sp|Q7Z2B8|MLCD_DICDI Myosin-ID light chain OS=Dictyostelium discoideum GN=mlcD PE=1 SV=1 5 144 1.0E-14
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 6 142 1.0E-14
sp|Q9SU00|CML2_ARATH Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1 18 146 2.0E-14
sp|P18666|ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus GN=Myl12b PE=1 SV=3 8 146 2.0E-14
sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 6 148 2.0E-14
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 18 143 2.0E-14
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 6 142 2.0E-14
sp|Q96GE6|CALL4_HUMAN Calmodulin-like protein 4 OS=Homo sapiens GN=CALML4 PE=2 SV=3 6 142 2.0E-14
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 5 142 2.0E-14
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 4 146 2.0E-14
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 18 143 2.0E-14
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 6 148 3.0E-14
sp|Q8CI43|MYL6B_MOUSE Myosin light chain 6B OS=Mus musculus GN=Myl6b PE=1 SV=1 4 147 3.0E-14
sp|Q6F334|CML9_ORYSJ Probable calcium-binding protein CML9 OS=Oryza sativa subsp. japonica GN=CML9 PE=2 SV=1 5 146 3.0E-14
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 6 148 3.0E-14
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 4 146 3.0E-14
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 6 148 4.0E-14
sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 6 148 5.0E-14
sp|P13832|MRLCA_RAT Myosin regulatory light chain RLC-A OS=Rattus norvegicus GN=Rlc-a PE=2 SV=2 8 146 6.0E-14
sp|Q8RYJ8|CML19_ORYSJ Putative calcium-binding protein CML19 OS=Oryza sativa subsp. japonica GN=CML19 PE=3 SV=1 14 143 6.0E-14
sp|O01305|CAVP_BRAFL Calcium vector protein OS=Branchiostoma floridae PE=2 SV=3 18 142 7.0E-14
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 6 142 7.0E-14
sp|P24032|MLRN_CHICK Myosin regulatory light chain 2, smooth muscle minor isoform OS=Gallus gallus PE=2 SV=2 8 146 8.0E-14
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 18 147 8.0E-14
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 6 142 9.0E-14
sp|P02605|MLE3_CHICK Myosin light chain 3, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 4 147 9.0E-14
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 18 148 1.0E-13
sp|P04573|CAVP_BRALA Calcium vector protein OS=Branchiostoma lanceolatum PE=1 SV=3 18 142 1.0E-13
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 14 143 1.0E-13
sp|P21788|SP15_HEMPU 15 kDa calcium-binding protein OS=Hemicentrotus pulcherrimus PE=1 SV=1 24 148 1.0E-13
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 5 148 2.0E-13
sp|Q0JC44|CML22_ORYSJ Probable calcium-binding protein CML22 OS=Oryza sativa subsp. japonica GN=CML22 PE=3 SV=1 18 146 2.0E-13
sp|Q3SEK0|CATR5_PARTE Caltractin ICL1e OS=Paramecium tetraurelia GN=Icl1e PE=3 SV=1 6 133 2.0E-13
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 8 147 2.0E-13
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 9 143 2.0E-13
sp|Q2QVI1|CML28_ORYSJ Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica GN=CML28 PE=2 SV=1 15 146 2.0E-13
sp|Q9FIH9|CML37_ARATH Calcium-binding protein CML37 OS=Arabidopsis thaliana GN=CML37 PE=2 SV=1 10 142 3.0E-13
sp|Q9XVI9|MLC5_CAEEL Myosin-2 essential light chain OS=Caenorhabditis elegans GN=mlc-5 PE=1 SV=1 9 146 5.0E-13
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 6 148 6.0E-13
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 6 148 6.0E-13
sp|P05976|MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens GN=MYL1 PE=2 SV=3 4 147 8.0E-13
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 14 143 8.0E-13
sp|Q64122|MYL9_RAT Myosin regulatory light polypeptide 9 OS=Rattus norvegicus GN=Myl9 PE=1 SV=2 8 146 1.0E-12
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 15 148 1.0E-12
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 15 148 1.0E-12
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 6 148 1.0E-12
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 6 142 2.0E-12
sp|Q9SRP4|CML33_ARATH Probable calcium-binding protein CML33 OS=Arabidopsis thaliana GN=CML33 PE=2 SV=1 16 137 2.0E-12
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 6 148 2.0E-12
sp|P82160|MLE3_LIZRA Myosin light chain 3, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 5 147 3.0E-12
sp|P02602|MYL1_RABIT Myosin light chain 1/3, skeletal muscle isoform OS=Oryctolagus cuniculus GN=MYL1 PE=1 SV=3 4 147 3.0E-12
sp|Q9BXU9|CABP8_HUMAN Calcium-binding protein 8 OS=Homo sapiens GN=CALN1 PE=2 SV=1 5 110 3.0E-12
sp|P13543|MLR_ARGIR Myosin regulatory light chain, striated adductor muscle OS=Argopecten irradians PE=1 SV=3 5 146 3.0E-12
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 6 142 4.0E-12
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 6 142 4.0E-12
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 14 143 4.0E-12
sp|Q39584|DYL3_CHLRE Dynein 18 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 6 147 4.0E-12
sp|Q06BI3|CABP8_RAT Calcium-binding protein 8 OS=Rattus norvegicus GN=Caln1 PE=1 SV=1 5 110 5.0E-12
sp|Q9JJG7|CABP8_MOUSE Calcium-binding protein 8 OS=Mus musculus GN=Caln1 PE=2 SV=1 5 110 5.0E-12
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 6 142 5.0E-12
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 9 143 5.0E-12
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 6 148 5.0E-12
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 9 143 6.0E-12
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 6 142 7.0E-12
sp|P02604|MLE1_CHICK Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 4 147 7.0E-12
sp|P05963|MLR_CHLNI Myosin regulatory light chain, striated adductor muscle OS=Chlamys nipponensis akazara PE=1 SV=1 5 146 8.0E-12
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 6 142 8.0E-12
sp|P35622|TNNC_MIZYE Troponin C OS=Mizuhopecten yessoensis PE=1 SV=1 2 148 9.0E-12
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 9 78 1.0E-11
sp|A0JNJ5|MYL1_BOVIN Myosin light chain 1/3, skeletal muscle isoform OS=Bos taurus GN=MYL1 PE=2 SV=1 4 148 1.0E-11
sp|Q9SS31|CML36_ARATH Probable calcium-binding protein CML36 OS=Arabidopsis thaliana GN=CML36 PE=2 SV=1 17 146 1.0E-11
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 6 142 1.0E-11
sp|P05944|MLRC_MIZYE Myosin regulatory light chain, striated adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 146 1.0E-11
sp|P02613|MLR_PATSP Myosin regulatory light chain OS=Patinopecten sp. PE=1 SV=1 5 146 1.0E-11
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus GN=PPP3R2 PE=2 SV=3 8 148 2.0E-11
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 6 148 2.0E-11
sp|P02600|MYL1_RAT Myosin light chain 1/3, skeletal muscle isoform OS=Rattus norvegicus GN=Myl1 PE=1 SV=2 4 147 2.0E-11
sp|P40423|SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster GN=sqh PE=1 SV=1 10 147 2.0E-11
sp|Q54LX0|CBPM_DICDI Calcium-binding protein M OS=Dictyostelium discoideum GN=cbpM PE=1 SV=1 6 142 3.0E-11
sp|Q09196|MLR4_SCHPO Myosin regulatory light chain cdc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc4 PE=1 SV=1 12 146 3.0E-11
sp|P05977|MYL1_MOUSE Myosin light chain 1/3, skeletal muscle isoform OS=Mus musculus GN=Myl1 PE=1 SV=2 4 147 3.0E-11
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 6 142 3.0E-11
sp|Q2QYW1|CML25_ORYSJ Probable calcium-binding protein CML25/26 OS=Oryza sativa subsp. japonica GN=CML25 PE=3 SV=1 22 143 3.0E-11
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 80 148 3.0E-11
sp|P02606|MLEC_CHICK Myosin light chain 1, cardiac muscle OS=Gallus gallus PE=1 SV=3 4 144 4.0E-11
sp|P16409|MYL3_RAT Myosin light chain 3 OS=Rattus norvegicus GN=Myl3 PE=1 SV=2 4 148 4.0E-11
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNB1 PE=1 SV=3 9 148 4.0E-11
sp|Q9SRE6|CML38_ARATH Calcium-binding protein CML38 OS=Arabidopsis thaliana GN=CML38 PE=2 SV=1 2 142 5.0E-11
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 6 148 5.0E-11
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 9 143 6.0E-11
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 8 143 7.0E-11
sp|P21798|TNNC2_BALNU Troponin C, isoform 2 OS=Balanus nubilus PE=1 SV=2 5 148 8.0E-11
sp|P48593|E631_DROME Calcium-binding protein E63-1 OS=Drosophila melanogaster GN=Eip63F-1 PE=2 SV=2 6 146 8.0E-11
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CNB1 PE=3 SV=1 6 142 8.0E-11
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 16 146 9.0E-11
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 16 146 9.0E-11
sp|Q502J0|PCAT2_DANRE Lysophosphatidylcholine acyltransferase 2 OS=Danio rerio GN=lpcat2 PE=2 SV=1 27 143 1.0E-10
sp|Q8RYK0|CML31_ORYSJ Probable calcium-binding protein CML31 OS=Oryza sativa subsp. japonica GN=CML31 PE=2 SV=1 18 148 1.0E-10
sp|O14008|CAM2_SCHPO Myosin 1 light chain cam2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam2 PE=1 SV=1 4 147 2.0E-10
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 6 107 2.0E-10
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 6 107 2.0E-10
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 6 107 2.0E-10
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 9 146 2.0E-10
sp|Q9SRE7|CML39_ARATH Calcium-binding protein CML39 OS=Arabidopsis thaliana GN=CML39 PE=2 SV=1 4 142 2.0E-10
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 6 148 2.0E-10
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 6 142 3.0E-10
sp|P09541|MYL4_MOUSE Myosin light chain 4 OS=Mus musculus GN=Myl4 PE=1 SV=3 6 148 3.0E-10
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 3 143 3.0E-10
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 6 107 3.0E-10
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 77 148 4.0E-10
sp|P18432|MLR_DROME Myosin regulatory light chain 2 OS=Drosophila melanogaster GN=Mlc2 PE=1 SV=2 6 122 4.0E-10
sp|P04112|MLRB_MIZYE Myosin regulatory light chain B, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 146 4.0E-10
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 10 144 4.0E-10
sp|P53141|MLC1_YEAST Myosin light chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLC1 PE=1 SV=1 13 142 4.0E-10
sp|P17209|MYL4_RAT Myosin light chain 4 OS=Rattus norvegicus GN=Myl4 PE=2 SV=2 6 148 4.0E-10
sp|P09542|MYL3_MOUSE Myosin light chain 3 OS=Mus musculus GN=Myl3 PE=1 SV=4 4 148 4.0E-10
sp|P13833|MLR_DICDI Myosin regulatory light chain OS=Dictyostelium discoideum GN=mlcR PE=2 SV=1 6 126 4.0E-10
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 9 146 5.0E-10
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 2 143 5.0E-10
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 13 143 5.0E-10
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 9 146 5.0E-10
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 6 147 6.0E-10
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CNB1 PE=3 SV=1 9 143 6.0E-10
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 85 148 7.0E-10
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 11 143 7.0E-10
sp|P34368|YLJ5_CAEEL Uncharacterized calcium-binding protein C50C3.5 OS=Caenorhabditis elegans GN=C50C3.5 PE=3 SV=3 6 142 8.0E-10
sp|Q5R887|MYL3_PONAB Myosin light chain 3 OS=Pongo abelii GN=MYL3 PE=2 SV=3 4 148 8.0E-10
sp|P08590|MYL3_HUMAN Myosin light chain 3 OS=Homo sapiens GN=MYL3 PE=1 SV=3 4 148 8.0E-10
sp|P07462|MLE_HALRO Myosin catalytic light chain, smooth muscle OS=Halocynthia roretzi PE=1 SV=1 6 146 8.0E-10
sp|Q1HPS0|MLR_BOMMO Myosin regulatory light chain 2 OS=Bombyx mori PE=1 SV=1 6 148 8.0E-10
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 85 147 9.0E-10
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 85 147 9.0E-10
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 11 143 9.0E-10
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 85 148 1.0E-09
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 11 80 1.0E-09
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 18 143 1.0E-09
sp|P12829|MYL4_HUMAN Myosin light chain 4 OS=Homo sapiens GN=MYL4 PE=1 SV=3 6 148 1.0E-09
sp|Q17133|MLE_BRAFL Myosin, essential light chain OS=Branchiostoma floridae PE=2 SV=1 6 146 1.0E-09
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 9 148 1.0E-09
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 9 148 1.0E-09
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 9 148 1.0E-09
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 9 148 1.0E-09
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 16 142 1.0E-09
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 6 107 1.0E-09
sp|Q6Z2J1|CML20_ORYSJ Probable calcium-binding protein CML20 OS=Oryza sativa subsp. japonica GN=CML20 PE=2 SV=1 18 147 1.0E-09
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 6 107 1.0E-09
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 6 107 1.0E-09
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 6 107 1.0E-09
sp|P08052|MLR_TODPA Myosin regulatory light chain LC-2, mantle muscle OS=Todarodes pacificus PE=1 SV=1 4 129 1.0E-09
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 89 147 2.0E-09
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 15 79 2.0E-09
sp|Q9BXU9|CABP8_HUMAN Calcium-binding protein 8 OS=Homo sapiens GN=CALN1 PE=2 SV=1 84 147 2.0E-09
sp|Q06BI3|CABP8_RAT Calcium-binding protein 8 OS=Rattus norvegicus GN=Caln1 PE=1 SV=1 84 147 2.0E-09
sp|Q9JJG7|CABP8_MOUSE Calcium-binding protein 8 OS=Mus musculus GN=Caln1 PE=2 SV=1 84 147 2.0E-09
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 7 76 2.0E-09
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 10 147 2.0E-09
sp|Q09510|MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans GN=mlc-4 PE=1 SV=1 10 147 2.0E-09
sp|Q54X77|CETNB_DICDI Centrin-B OS=Dictyostelium discoideum GN=cenB PE=3 SV=1 5 148 2.0E-09
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 9 146 2.0E-09
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 85 147 3.0E-09
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 85 148 3.0E-09
sp|P38505|CALBP_ENTHI Calcium-binding protein OS=Entamoeba histolytica PE=1 SV=2 18 142 3.0E-09
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens GN=PPP3R2 PE=1 SV=3 9 146 3.0E-09
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 85 147 4.0E-09
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 85 147 4.0E-09
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 85 147 4.0E-09
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 85 147 4.0E-09
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 3 143 4.0E-09
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 6 107 4.0E-09
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 6 107 4.0E-09
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 6 107 4.0E-09
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 85 147 5.0E-09
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 85 147 5.0E-09
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 85 147 5.0E-09
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 85 147 5.0E-09
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 18 143 5.0E-09
sp|Q8RYJ9|CML23_ORYSJ Putative calcium-binding protein CML23 OS=Oryza sativa subsp. japonica GN=CML23 PE=3 SV=1 14 146 5.0E-09
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 6 98 5.0E-09
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 85 147 6.0E-09
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 85 147 6.0E-09
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 85 147 6.0E-09
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 6 147 6.0E-09
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 6 107 6.0E-09
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 18 143 6.0E-09
sp|O82040|POLC7_PHLPR Polcalcin Phl p 7 OS=Phleum pratense PE=1 SV=1 18 79 7.0E-09
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 85 147 8.0E-09
sp|Q66H96|CABP7_RAT Calcium-binding protein 7 OS=Rattus norvegicus GN=Cabp7 PE=1 SV=1 84 147 8.0E-09
sp|Q866X0|CABP7_PAPAN Calcium-binding protein 7 OS=Papio anubis GN=CABP7 PE=3 SV=1 84 147 8.0E-09
sp|Q91ZM8|CABP7_MOUSE Calcium-binding protein 7 OS=Mus musculus GN=Cabp7 PE=2 SV=1 84 147 8.0E-09
sp|Q86V35|CABP7_HUMAN Calcium-binding protein 7 OS=Homo sapiens GN=CABP7 PE=1 SV=1 84 147 8.0E-09
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 85 147 9.0E-09
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 85 147 9.0E-09
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 7 76 9.0E-09
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 82 147 1.0E-08
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 82 147 1.0E-08
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 82 147 1.0E-08
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 82 147 1.0E-08
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 82 147 1.0E-08
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 82 147 1.0E-08
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 82 147 1.0E-08
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 82 147 1.0E-08
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 82 147 1.0E-08
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 82 147 1.0E-08
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 82 147 1.0E-08
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 85 147 1.0E-08
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 8 78 1.0E-08
sp|Q39584|DYL3_CHLRE Dynein 18 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 73 146 1.0E-08
sp|P09402|MLE_DICDI Myosin, essential light chain OS=Dictyostelium discoideum GN=mlcE PE=2 SV=2 4 132 1.0E-08
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 5 142 1.0E-08
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus GN=Ppp3r2 PE=2 SV=2 9 148 1.0E-08
sp|P85100|MYL3_BOVIN Myosin light chain 3 OS=Bos taurus GN=MYL3 PE=1 SV=1 4 144 1.0E-08
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 15 83 2.0E-08
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 85 147 2.0E-08
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 82 147 2.0E-08
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 82 147 2.0E-08
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 82 147 2.0E-08
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 82 147 2.0E-08
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 82 147 2.0E-08
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 82 147 2.0E-08
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 82 147 2.0E-08
sp|P94092|POLC7_CYNDA Polcalcin Cyn d 7 OS=Cynodon dactylon PE=1 SV=2 18 79 2.0E-08
sp|Q5Z676|CML29_ORYSJ Probable calcium-binding protein CML29 OS=Oryza sativa subsp. japonica GN=CML29 PE=2 SV=1 11 143 2.0E-08
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 43 143 2.0E-08
sp|P07290|MLE_MIZYE Myosin, essential light chain, adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 148 2.0E-08
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 6 148 2.0E-08
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 85 147 3.0E-08
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 85 147 3.0E-08
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 85 147 3.0E-08
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 85 147 3.0E-08
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 85 147 3.0E-08
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 85 147 3.0E-08
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 85 147 3.0E-08
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 85 147 3.0E-08
sp|P07291|MLE_ARGIR Myosin essential light chain, striated adductor muscle OS=Argopecten irradians PE=1 SV=2 5 148 3.0E-08
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 16 77 4.0E-08
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 16 77 4.0E-08
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 85 147 4.0E-08
sp|Q9VQH2|DUOX_DROME Dual oxidase OS=Drosophila melanogaster GN=Duox PE=1 SV=2 29 113 4.0E-08
sp|P04113|MLRA_MIZYE Myosin regulatory light chain A, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 15 146 4.0E-08
sp|P30188|CML35_ARATH Probable calcium-binding protein CML35 OS=Arabidopsis thaliana GN=CML35 PE=2 SV=2 17 146 4.0E-08
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 7 74 5.0E-08
sp|P79880|GUC1A_CHICK Guanylyl cyclase-activating protein 1 OS=Gallus gallus GN=GUCA1A PE=1 SV=3 27 142 5.0E-08
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 82 147 7.0E-08
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 85 147 7.0E-08
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 85 147 7.0E-08
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 15 74 7.0E-08
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 84 142 7.0E-08
sp|P69196|POLC1_BRANA Polcalcin Bra n 1 OS=Brassica napus PE=1 SV=1 18 79 7.0E-08
sp|P69197|POLC1_BRACM Polcalcin Bra r 1 OS=Brassica campestris PE=1 SV=1 18 79 7.0E-08
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 7 71 8.0E-08
sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 6 112 8.0E-08
sp|P62759|NCALD_TAEGU Neurocalcin-delta OS=Taeniopygia guttata GN=NCALD PE=2 SV=2 27 144 8.0E-08
sp|P62758|NCALD_CHICK Neurocalcin-delta OS=Gallus gallus GN=NCALD PE=2 SV=2 27 144 8.0E-08
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 84 142 9.0E-08
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 15 81 9.0E-08
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 85 147 1.0E-07
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 85 147 1.0E-07
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 15 81 1.0E-07
sp|Q0JC44|CML22_ORYSJ Probable calcium-binding protein CML22 OS=Oryza sativa subsp. japonica GN=CML22 PE=3 SV=1 15 74 1.0E-07
sp|Q5PQN0|NCALD_RAT Neurocalcin-delta OS=Rattus norvegicus GN=Ncald PE=1 SV=3 27 144 1.0E-07
sp|Q91X97|NCALD_MOUSE Neurocalcin-delta OS=Mus musculus GN=Ncald PE=1 SV=4 27 144 1.0E-07
sp|Q4R4N4|NCALD_MACFA Neurocalcin-delta OS=Macaca fascicularis GN=NCALD PE=2 SV=3 27 144 1.0E-07
sp|P61601|NCALD_HUMAN Neurocalcin-delta OS=Homo sapiens GN=NCALD PE=1 SV=2 27 144 1.0E-07
sp|P61602|NCALD_BOVIN Neurocalcin-delta OS=Bos taurus GN=NCALD PE=1 SV=2 27 144 1.0E-07
sp|Q10LX4|CML27_ORYSJ Probable calcium-binding protein CML27 OS=Oryza sativa subsp. japonica GN=CML27 PE=2 SV=1 15 143 1.0E-07
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 5 148 1.0E-07
sp|Q9VJ26|EFHD2_DROME EF-hand domain-containing protein D2 homolog OS=Drosophila melanogaster GN=Swip-1 PE=2 SV=1 33 146 1.0E-07
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 6 107 1.0E-07
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 6 107 1.0E-07
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus musculus GN=Ppp3r2 PE=1 SV=3 8 148 1.0E-07
sp|Q4V8A1|PCT2B_RAT Lysophosphatidylcholine acyltransferase 2B OS=Rattus norvegicus GN=Lpcat2b PE=2 SV=1 4 144 1.0E-07
sp|P84076|HPCA_RAT Neuron-specific calcium-binding protein hippocalcin OS=Rattus norvegicus GN=Hpca PE=1 SV=2 48 144 1.0E-07
sp|Q06AT1|HPCA_PIG Neuron-specific calcium-binding protein hippocalcin OS=Sus scrofa GN=HPCA PE=2 SV=3 48 144 1.0E-07
sp|P84075|HPCA_MOUSE Neuron-specific calcium-binding protein hippocalcin OS=Mus musculus GN=Hpca PE=1 SV=2 48 144 1.0E-07
sp|P84074|HPCA_HUMAN Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens GN=HPCA PE=1 SV=2 48 144 1.0E-07
sp|Q4PL64|HPCA_BOVIN Neuron-specific calcium-binding protein hippocalcin OS=Bos taurus GN=HPCA PE=2 SV=3 48 144 1.0E-07
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 85 147 2.0E-07
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 15 74 2.0E-07
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 85 147 2.0E-07
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 15 78 2.0E-07
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 15 76 2.0E-07
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 83 145 2.0E-07
sp|A9JTH1|NCLDA_DANRE Neurocalcin-delta A OS=Danio rerio GN=ncalda PE=2 SV=1 27 142 2.0E-07
sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 27 142 2.0E-07
sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 27 142 2.0E-07
sp|Q54MF3|CANB2_DICDI Calcineurin subunit B type 2 OS=Dictyostelium discoideum GN=cnbB PE=3 SV=1 6 148 2.0E-07
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 6 107 2.0E-07
sp|Q9BUY7|EFC11_HUMAN EF-hand calcium-binding domain-containing protein 11 OS=Homo sapiens GN=EFCAB11 PE=2 SV=1 18 147 2.0E-07
sp|O81092|ALL3_OLEEU Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1 10 79 2.0E-07
sp|P80164|MLR_LUMTE Myosin regulatory light chain, striated muscle, 25 kDa isoform OS=Lumbricus terrestris PE=1 SV=1 6 147 2.0E-07
sp|Q9SRP7|CML28_ARATH Probable calcium-binding protein CML28 OS=Arabidopsis thaliana GN=CML28 PE=3 SV=1 18 79 2.0E-07
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 16 76 3.0E-07
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 16 77 3.0E-07
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 85 147 3.0E-07
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 17 78 3.0E-07
sp|Q8RYJ9|CML23_ORYSJ Putative calcium-binding protein CML23 OS=Oryza sativa subsp. japonica GN=CML23 PE=3 SV=1 84 147 3.0E-07
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 16 77 4.0E-07
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 16 77 4.0E-07
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 16 77 4.0E-07
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 16 77 4.0E-07
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 16 77 4.0E-07
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 15 83 4.0E-07
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 18 142 4.0E-07
sp|Q0JC44|CML22_ORYSJ Probable calcium-binding protein CML22 OS=Oryza sativa subsp. japonica GN=CML22 PE=3 SV=1 85 148 4.0E-07
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 16 76 5.0E-07
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 85 147 5.0E-07
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 85 147 5.0E-07
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 85 147 6.0E-07
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 15 77 6.0E-07
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 15 77 6.0E-07
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 85 148 7.0E-07
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 85 147 8.0E-07
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 85 147 8.0E-07
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 85 147 8.0E-07
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 85 147 8.0E-07
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 15 110 9.0E-07
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 15 77 9.0E-07
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 7 76 9.0E-07
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 85 147 9.0E-07
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 85 147 1.0E-06
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 85 147 1.0E-06
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 85 147 1.0E-06
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 15 77 1.0E-06
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 15 77 1.0E-06
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 85 147 1.0E-06
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 85 147 1.0E-06
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 7 70 1.0E-06
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 74 146 1.0E-06
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 85 147 1.0E-06
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 85 147 1.0E-06
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 9 78 1.0E-06
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 21 101 1.0E-06
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 15 77 2.0E-06
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 15 77 2.0E-06
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 15 77 2.0E-06
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 15 77 2.0E-06
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 85 147 2.0E-06
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 15 76 2.0E-06
sp|Q9AWK2|CML11_ORYSJ Probable calcium-binding protein CML11 OS=Oryza sativa subsp. japonica GN=CML11 PE=2 SV=1 7 81 2.0E-06
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 15 77 3.0E-06
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 15 77 3.0E-06
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 15 77 3.0E-06
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 15 77 3.0E-06
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 15 77 3.0E-06
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 15 77 3.0E-06
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 15 77 3.0E-06
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 15 77 3.0E-06
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 15 77 3.0E-06
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 15 77 3.0E-06
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 15 77 3.0E-06
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 15 77 3.0E-06
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 15 77 3.0E-06
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 15 77 3.0E-06
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 15 77 3.0E-06
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 15 77 3.0E-06
sp|Q9VJ26|EFHD2_DROME EF-hand domain-containing protein D2 homolog OS=Drosophila melanogaster GN=Swip-1 PE=2 SV=1 6 79 3.0E-06
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 15 77 4.0E-06
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 7 76 4.0E-06
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 15 76 4.0E-06
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 73 142 4.0E-06
sp|P21788|SP15_HEMPU 15 kDa calcium-binding protein OS=Hemicentrotus pulcherrimus PE=1 SV=1 12 76 4.0E-06
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 49 148 5.0E-06
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 83 142 5.0E-06
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 85 148 5.0E-06
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 1 86 5.0E-06
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 7 78 6.0E-06
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 12 74 6.0E-06
sp|Q9C9U8|CML26_ARATH Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1 82 148 6.0E-06
sp|Q9M8U1|CML18_ARATH Probable calcium-binding protein CML18 OS=Arabidopsis thaliana GN=CML18 PE=1 SV=1 7 82 7.0E-06
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 85 142 7.0E-06
sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 85 146 7.0E-06
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 15 77 8.0E-06
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 15 77 8.0E-06
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 15 77 8.0E-06
sp|Q9SU00|CML2_ARATH Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1 17 78 8.0E-06
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 15 76 9.0E-06
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 7 78 9.0E-06
sp|Q8RYJ8|CML19_ORYSJ Putative calcium-binding protein CML19 OS=Oryza sativa subsp. japonica GN=CML19 PE=3 SV=1 85 145 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005515 protein binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031640
MHPMKISEDQISAYRDSFQVFDTDGDGKLSPEELTAVMRSLDQNPTEKELEAIMAGMDIDRDGTVDFQEFLILMS
AHSGSNTDDEIRCAFETFDRDKNGTINIEELRCMMRKLRVPVTEEELHVMMKEADEDGDGVIDLQEFRRILSS*
Coding >AgabiH97|031640
ATGCATCCCATGAAAATCTCCGAAGATCAGATTTCCGCATACAGAGACTCCTTCCAAGTATTCGATACAGATGGC
GATGGCAAGCTATCCCCCGAAGAACTAACCGCAGTCATGCGCAGTTTGGATCAAAACCCGACTGAAAAAGAGCTG
GAAGCTATCATGGCAGGCATGGATATAGATCGCGATGGAACTGTCGATTTTCAAGAGTTCCTCATCCTTATGTCG
GCACACTCGGGGTCGAACACCGACGATGAAATACGCTGCGCTTTCGAGACTTTTGATAGGGACAAGAATGGGACT
ATCAATATCGAGGAGTTGAGATGTATGATGCGCAAGCTTCGGGTGCCAGTAACGGAGGAGGAACTGCATGTTATG
ATGAAAGAGGCTGATGAGGATGGTGATGGCGTCATCGATCTCCAAGAGTTTCGCCGCATCTTAAGCTCATGA
Transcript >AgabiH97|031640
ATGCATCCCATGAAAATCTCCGAAGATCAGATTTCCGCATACAGAGACTCCTTCCAAGTATTCGATACAGATGGC
GATGGCAAGCTATCCCCCGAAGAACTAACCGCAGTCATGCGCAGTTTGGATCAAAACCCGACTGAAAAAGAGCTG
GAAGCTATCATGGCAGGCATGGATATAGATCGCGATGGAACTGTCGATTTTCAAGAGTTCCTCATCCTTATGTCG
GCACACTCGGGGTCGAACACCGACGATGAAATACGCTGCGCTTTCGAGACTTTTGATAGGGACAAGAATGGGACT
ATCAATATCGAGGAGTTGAGATGTATGATGCGCAAGCTTCGGGTGCCAGTAACGGAGGAGGAACTGCATGTTATG
ATGAAAGAGGCTGATGAGGATGGTGATGGCGTCATCGATCTCCAAGAGTTTCGCCGCATCTTAAGCTCATGA
Gene >AgabiH97|031640
ATGCATCCCATGAAAATCGTACGTTTTCCAATAATTCTTCCGGGGCATGGGTGACCAAGCTTGTTTACTTGTCAA
GTCCGAAGGTTGGTCCCAAGCGCTTAGCTTTAATCGGCAATATCATTTCTTAACGGTTTGCAGATCAGATTTCCG
GTTCGTAGACCTGTCGGGTTTACGCTTATATGGGGGTGCTCAAACGTGTATTTTAGCATACAGAGACTCCTTCCA
AGTATTCGATACAGGTAAGAGTTGCGCCCTTTGTATGTTAGAACTCGCATTCACCTGTCGTGAATTTCTTGTAGA
TGGCGATGGCAAGCTATCCCCCGAAGAACTAACCGCAGTCATGCGCAGTTTGGATCAAAACCCGACTGAAAAAGA
GCTGGAAGCTATCATGGCAGGCATGGATATAGATCGCGATGGAACTGTCGATTTTCAAGAGTTCCTCATCCTTAT
GTCGGCACACTCGGGGTCGAACACCGACGATGAAATACGCTGCGCTTTCGAGACTTTTGATAGGGACAAGAATGG
GACTATCAATATCGAGGAGTTGAGATGTATGATGCGCAAGCTTCGGGTGCCAGTAACGGAGGAGGAACTGCATGT
TATGATGAAAGAGGCTGATGAGGATGGTGATGGCGTCATCGATCTCCAAGGTACGCCCGTTTATCGATTATCTCC
AGAGCTGACCGTGGTCATCTTACTTATCTGTTTCTCAGAGTTTCGCCGCGTGAGTCTAAACCATATCAGAACCTA
AACAGAACAATTGAAGGACGGTCAACAGATCTTAAGCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail