Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031530
Gene name
Locationscaffold_12:923649..926367
Strand+
Gene length (bp)2718
Transcript length (bp)2355
Coding sequence length (bp)2355
Protein length (aa) 785

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00330 Aconitase Aconitase family (aconitate hydratase) 6.2E-156 69 505
PF00694 Aconitase_C Aconitase C-terminal domain 1.6E-44 585 711

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8VG90|ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 21 781 0.0E+00
sp|Q4WLN1|ACON_ASPFU Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 31 781 0.0E+00
sp|O13966|ACON_SCHPO Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.06c PE=3 SV=2 23 778 0.0E+00
sp|D4AT77|ACON_ARTBC Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 19 782 0.0E+00
sp|P82611|ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 8 780 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8VG90|ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 21 781 0.0E+00
sp|Q4WLN1|ACON_ASPFU Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 31 781 0.0E+00
sp|O13966|ACON_SCHPO Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.06c PE=3 SV=2 23 778 0.0E+00
sp|D4AT77|ACON_ARTBC Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 19 782 0.0E+00
sp|P82611|ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 8 780 0.0E+00
sp|P19414|ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2 14 782 0.0E+00
sp|P34455|ACON_CAEEL Probable aconitate hydratase, mitochondrial OS=Caenorhabditis elegans GN=aco-2 PE=3 SV=2 32 775 0.0E+00
sp|P20004|ACON_BOVIN Aconitate hydratase, mitochondrial OS=Bos taurus GN=ACO2 PE=1 SV=4 33 775 0.0E+00
sp|Q99798|ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens GN=ACO2 PE=1 SV=2 33 775 0.0E+00
sp|Q99KI0|ACON_MOUSE Aconitate hydratase, mitochondrial OS=Mus musculus GN=Aco2 PE=1 SV=1 33 775 0.0E+00
sp|Q9ER34|ACON_RAT Aconitate hydratase, mitochondrial OS=Rattus norvegicus GN=Aco2 PE=1 SV=2 33 775 0.0E+00
sp|Q54XS2|ACON_DICDI Probable aconitate hydratase, mitochondrial OS=Dictyostelium discoideum GN=aco2 PE=3 SV=1 18 782 0.0E+00
sp|P16276|ACON_PIG Aconitate hydratase, mitochondrial OS=Sus scrofa GN=ACO2 PE=1 SV=1 33 775 0.0E+00
sp|P49609|ACON_GRAGA Aconitate hydratase, mitochondrial OS=Gracilaria gracilis PE=3 SV=1 47 777 0.0E+00
sp|Q9P7D4|ACON2_SCHPO Homocitrate dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.15 PE=3 SV=3 47 783 0.0E+00
sp|P39533|ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO2 PE=1 SV=1 47 777 0.0E+00
sp|Q4WJ90|ACON2_ASPFU Putative aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoB PE=2 SV=1 47 781 0.0E+00
sp|Q5B6D6|ACON2_EMENI Putative aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoB PE=3 SV=1 47 780 0.0E+00
sp|Q1RKD5|ACNA_RICBR Aconitate hydratase A OS=Rickettsia bellii (strain RML369-C) GN=acnA PE=3 SV=1 140 783 9.0E-63
sp|Q5SMF6|ACNA_THET8 Aconitate hydratase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acoA PE=3 SV=1 121 777 1.0E-61
sp|Q94A28|ACO3M_ARATH Aconitate hydratase 3, mitochondrial OS=Arabidopsis thaliana GN=ACO3 PE=2 SV=3 91 711 4.0E-60
sp|Q42560|ACO1_ARATH Aconitate hydratase 1 OS=Arabidopsis thaliana GN=ACO1 PE=1 SV=2 91 711 2.0E-59
sp|P49608|ACOC_CUCMA Aconitate hydratase, cytoplasmic OS=Cucurbita maxima PE=2 SV=1 91 765 3.0E-59
sp|Q68VV0|ACNA_RICTY Aconitate hydratase A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=acnA PE=3 SV=1 123 782 4.0E-58
sp|Q937N8|ACNA_CUPNE Aconitate hydratase A OS=Cupriavidus necator GN=acnM PE=1 SV=1 95 776 1.0E-57
sp|Q6YZX6|ACOC_ORYSJ Putative aconitate hydratase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os08g0191100 PE=3 SV=1 91 765 1.0E-57
sp|Q9ZCF4|ACNA_RICPR Aconitate hydratase A OS=Rickettsia prowazekii (strain Madrid E) GN=acnA PE=3 SV=1 123 782 2.0E-57
sp|P70920|ACNA_BRADU Aconitate hydratase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acnA PE=2 SV=2 91 780 6.0E-57
sp|Q8EJW3|ACND_SHEON 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) OS=Shewanella oneidensis (strain MR-1) GN=acnD PE=1 SV=1 95 778 7.0E-57
sp|P09339|ACNA_BACSU Aconitate hydratase A OS=Bacillus subtilis (strain 168) GN=citB PE=1 SV=4 93 777 8.0E-57
sp|Q4UK20|ACNA_RICFE Aconitate hydratase A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=acnA PE=3 SV=1 114 782 2.0E-56
sp|Q92G90|ACNA_RICCN Aconitate hydratase A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=acnA PE=3 SV=1 114 782 1.0E-55
sp|Q9SIB9|ACO2M_ARATH Aconitate hydratase 2, mitochondrial OS=Arabidopsis thaliana GN=ACO2 PE=1 SV=2 91 720 4.0E-55
sp|Q42669|ACOC_CUCMC Aconitate hydratase (Fragment) OS=Cucumis melo var. conomon GN=ACO PE=2 SV=1 141 780 1.0E-53
sp|Q59938|ACNA_STRMU Aconitate hydratase A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=acn PE=3 SV=2 49 713 8.0E-52
sp|P63434|ACNA_STAAW Aconitate hydratase A OS=Staphylococcus aureus (strain MW2) GN=acnA PE=3 SV=1 81 777 3.0E-51
sp|Q6G9K9|ACNA_STAAS Aconitate hydratase A OS=Staphylococcus aureus (strain MSSA476) GN=acnA PE=3 SV=1 81 777 3.0E-51
sp|P99148|ACNA_STAAN Aconitate hydratase A OS=Staphylococcus aureus (strain N315) GN=acnA PE=1 SV=1 81 777 3.0E-51
sp|P63433|ACNA_STAAM Aconitate hydratase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=acnA PE=3 SV=1 81 777 3.0E-51
sp|Q5HG69|ACNA_STAAC Aconitate hydratase A OS=Staphylococcus aureus (strain COL) GN=acnA PE=3 SV=1 81 777 3.0E-51
sp|Q6GH55|ACNA_STAAR Aconitate hydratase A OS=Staphylococcus aureus (strain MRSA252) GN=acnA PE=3 SV=1 81 777 3.0E-51
sp|Q23500|ACOC_CAEEL Probable cytoplasmic aconitate hydratase OS=Caenorhabditis elegans GN=aco-1 PE=1 SV=1 86 737 7.0E-51
sp|P21399|ACOC_HUMAN Cytoplasmic aconitate hydratase OS=Homo sapiens GN=ACO1 PE=1 SV=3 93 731 7.0E-50
sp|Q2A1K3|ACNA_FRATH Aconitate hydratase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=acn PE=3 SV=1 124 777 8.0E-50
sp|Q8FTA8|ACNA_COREF Aconitate hydratase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=acn PE=3 SV=2 123 777 8.0E-50
sp|Q54X73|ACOC_DICDI Probable cytoplasmic aconitate hydratase OS=Dictyostelium discoideum GN=aco1 PE=3 SV=1 91 711 2.0E-49
sp|Q8CPC2|ACNA_STAES Aconitate hydratase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=acnA PE=3 SV=1 93 711 5.0E-49
sp|Q5HPJ0|ACNA_STAEQ Aconitate hydratase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=acnA PE=3 SV=1 93 777 5.0E-49
sp|Q2HZ33|LYS4_CANPA Homoaconitase, mitochondrial OS=Candida parapsilosis GN=LYS4 PE=3 SV=1 61 721 1.0E-47
sp|Q8ZP52|ACNA_SALTY Aconitate hydratase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acnA PE=1 SV=1 94 754 4.0E-47
sp|Q9WZ24|LEUC2_THEMA 3-isopropylmalate dehydratase large subunit 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC2 PE=3 SV=1 65 492 5.0E-47
sp|P37032|ACON_LEGPH Aconitate hydratase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=acn PE=1 SV=1 91 783 5.0E-47
sp|O27668|HACA_METTH Probable methanogen homoaconitase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hacA PE=3 SV=1 91 508 8.0E-47
sp|O28084|LEUC2_ARCFU 3-isopropylmalate dehydratase large subunit 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC2 PE=3 SV=1 96 492 1.0E-46
sp|Q9RTN7|ACNA_DEIRA Aconitate hydratase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acn PE=1 SV=1 91 777 2.0E-46
sp|Q4JVM4|ACNA_CORJK Aconitate hydratase A OS=Corynebacterium jeikeium (strain K411) GN=acn PE=3 SV=1 91 777 2.0E-45
sp|Q62751|IREB2_RAT Iron-responsive element-binding protein 2 OS=Rattus norvegicus GN=Ireb2 PE=1 SV=2 78 780 6.0E-45
sp|Q4WUL6|LYS4_ASPFU Homoaconitase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lys4 PE=2 SV=1 64 508 7.0E-45
sp|B3VKQ2|IREB2_PIG Iron-responsive element-binding protein 2 OS=Sus scrofa GN=IREB2 PE=2 SV=1 78 780 1.0E-44
sp|P25516|ACNA_ECOLI Aconitate hydratase A OS=Escherichia coli (strain K12) GN=acnA PE=1 SV=3 74 754 1.0E-44
sp|Q9I3F5|ACNA_PSEAE Aconitate hydratase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acnA PE=3 SV=1 91 777 1.0E-44
sp|Q6L0K5|LEUC_PICTO 3-isopropylmalate dehydratase large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=leuC PE=3 SV=1 76 508 2.0E-44
sp|Q9WYC7|LEUC1_THEMA 3-isopropylmalate dehydratase large subunit 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC1 PE=3 SV=1 66 508 3.0E-44
sp|Q0VCU1|ACOC_BOVIN Cytoplasmic aconitate hydratase OS=Bos taurus GN=ACO1 PE=2 SV=1 93 731 3.0E-44
sp|P0CM03|LYS4_CRYNB Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LYS4 PE=3 SV=1 64 481 4.0E-44
sp|P0CM02|LYS4_CRYNJ Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LYS4 PE=3 SV=1 64 481 4.0E-44
sp|Q58409|HACA_METJA Methanogen homoaconitase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hacA PE=1 SV=1 65 508 5.0E-44
sp|Q92412|LYS4_EMENI Homoaconitase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lys4 PE=3 SV=2 64 508 1.0E-43
sp|P28271|ACOC_MOUSE Cytoplasmic aconitate hydratase OS=Mus musculus GN=Aco1 PE=1 SV=3 93 731 2.0E-43
sp|B2KBD7|LEUC_ELUMP 3-isopropylmalate dehydratase large subunit OS=Elusimicrobium minutum (strain Pei191) GN=leuC PE=3 SV=1 64 508 2.0E-43
sp|Q811J3|IREB2_MOUSE Iron-responsive element-binding protein 2 OS=Mus musculus GN=Ireb2 PE=1 SV=2 139 780 2.0E-43
sp|P48200|IREB2_HUMAN Iron-responsive element-binding protein 2 OS=Homo sapiens GN=IREB2 PE=1 SV=3 78 780 3.0E-43
sp|Q58FL6|LYS4_ASPNC Homoaconitase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lysA PE=3 SV=1 64 508 5.0E-43
sp|Q90875|ACOC_CHICK Cytoplasmic aconitate hydratase OS=Gallus gallus GN=ACO1 PE=2 SV=1 93 783 6.0E-43
sp|O28316|LEUC1_ARCFU 3-isopropylmalate dehydratase large subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC1 PE=3 SV=2 66 508 9.0E-43
sp|Q01059|ACOC_RABIT Cytoplasmic aconitate hydratase OS=Oryctolagus cuniculus GN=ACO1 PE=1 SV=1 93 731 1.0E-42
sp|Q6C791|LYS4_YARLI Homoaconitase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS4 PE=3 SV=1 50 519 3.0E-42
sp|Q6CT61|LYS4_KLULA Homoaconitase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LYS4 PE=3 SV=1 67 721 3.0E-42
sp|Q63270|ACOC_RAT Cytoplasmic aconitate hydratase OS=Rattus norvegicus GN=Aco1 PE=1 SV=1 93 731 3.0E-42
sp|Q5ZLQ4|IREB2_CHICK Iron-responsive element-binding protein 2 OS=Gallus gallus GN=IREB2 PE=2 SV=1 170 780 3.0E-42
sp|Q97EE0|LEUC_CLOAB 3-isopropylmalate dehydratase large subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuC PE=3 SV=1 61 481 4.0E-42
sp|O67078|LEUC_AQUAE 3-isopropylmalate dehydratase large subunit OS=Aquifex aeolicus (strain VF5) GN=leuC PE=3 SV=1 65 508 4.0E-42
sp|Q6BM98|LYS4_DEBHA Homoaconitase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LYS4 PE=3 SV=1 61 721 4.0E-42
sp|Q2U9G3|LYS4_ASPOR Homoaconitase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lys4 PE=3 SV=1 23 508 5.0E-42
sp|A4XJ48|LEUC_CALS8 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuC PE=3 SV=1 61 481 2.0E-41
sp|Q8TVF2|LEUC1_METKA 3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC1 PE=3 SV=1 66 481 2.0E-41
sp|B4U7U5|LEUC_HYDS0 3-isopropylmalate dehydratase large subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=leuC PE=3 SV=1 140 508 3.0E-41
sp|Q2RG98|LEUC_MOOTA 3-isopropylmalate dehydratase large subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=leuC PE=3 SV=1 65 508 3.0E-41
sp|Q8U2A1|LEUC1_PYRFU 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC1 PE=3 SV=1 65 508 3.0E-41
sp|Q5A644|LYS4_CANAL Homoaconitase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LYS4 PE=3 SV=1 61 713 4.0E-41
sp|Q74BX5|LEUC_GEOSL 3-isopropylmalate dehydratase large subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuC PE=3 SV=1 66 508 8.0E-41
sp|Q75DX9|LYS4_ASHGO Homoaconitase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS4 PE=3 SV=2 68 481 1.0E-40
sp|Q8RDK2|LEUC_CALS4 3-isopropylmalate dehydratase large subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuC PE=3 SV=1 65 481 5.0E-40
sp|B9MLV4|LEUC_CALBD 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=leuC PE=3 SV=1 61 481 6.0E-40
sp|B8J4F9|LEUC_DESDA 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=leuC PE=3 SV=1 66 508 1.0E-39
sp|Q9UZ07|LEUC1_PYRAB 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC1 PE=3 SV=1 65 508 1.0E-39
sp|A5MZ75|LEUC_CLOK5 3-isopropylmalate dehydratase large subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuC PE=3 SV=1 65 481 4.0E-39
sp|Q39W70|LEUC_GEOMG 3-isopropylmalate dehydratase large subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuC PE=3 SV=1 66 508 6.0E-39
sp|B0TCR2|LEUC_HELMI 3-isopropylmalate dehydratase large subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuC PE=3 SV=1 65 507 8.0E-39
sp|A7IA28|LEUC_METB6 3-isopropylmalate dehydratase large subunit OS=Methanoregula boonei (strain 6A8) GN=leuC PE=3 SV=1 81 508 1.0E-38
sp|B8CX22|LEUC_HALOH 3-isopropylmalate dehydratase large subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuC PE=3 SV=1 65 481 1.0E-38
sp|B2UYH6|LEUC_CLOBA 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=leuC PE=3 SV=1 65 481 2.0E-38
sp|A0JMA0|IREB2_XENTR Iron-responsive element-binding protein 2 OS=Xenopus tropicalis GN=ireb2 PE=2 SV=1 137 780 2.0E-38
sp|A9A043|LEUC_DESOH 3-isopropylmalate dehydratase large subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=leuC PE=3 SV=1 66 489 3.0E-38
sp|A5G7U4|LEUC_GEOUR 3-isopropylmalate dehydratase large subunit OS=Geobacter uraniireducens (strain Rf4) GN=leuC PE=3 SV=1 65 508 3.0E-38
sp|Q4HVQ9|LYS4_GIBZE Homoaconitase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LYS4 PE=3 SV=1 61 508 4.0E-38
sp|Q0QLE2|DMDA_EUBBA 2,3-dimethylmalate dehydratase large subunit OS=Eubacterium barkeri GN=dmdA PE=1 SV=1 65 508 5.0E-38
sp|Q30WD3|LEUC_DESAG 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio alaskensis (strain G20) GN=leuC PE=3 SV=1 66 481 5.0E-38
sp|Q24XT4|LEUC_DESHY 3-isopropylmalate dehydratase large subunit OS=Desulfitobacterium hafniense (strain Y51) GN=leuC PE=3 SV=2 65 508 6.0E-38
sp|Q6FM51|LYS4_CANGA Homoaconitase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS4 PE=3 SV=1 57 721 7.0E-38
sp|Q870W1|LYS4_NEUCR Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 64 508 8.0E-38
sp|Q8PZT3|HACA_METMA Probable methanogen homoaconitase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hacA PE=3 SV=1 96 481 2.0E-37
sp|B0K0Y2|LEUC_THEPX 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter sp. (strain X514) GN=leuC PE=3 SV=1 65 481 3.0E-37
sp|B2TIQ9|LEUC_CLOBB 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=leuC PE=3 SV=1 65 481 3.0E-37
sp|Q6NTP2|IREB2_XENLA Iron-responsive element-binding protein 2 OS=Xenopus laevis GN=ireb2 PE=2 SV=1 138 780 4.0E-37
sp|Q8TLF1|HACA_METAC Probable methanogen homoaconitase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hacA PE=3 SV=1 96 481 4.0E-37
sp|Q8EN69|LEUC_OCEIH 3-isopropylmalate dehydratase large subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuC PE=3 SV=1 147 507 9.0E-37
sp|P18250|LEUC_PHYB8 3-isopropylmalate dehydratase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=leu1 PE=3 SV=2 173 737 1.0E-36
sp|Q7M9Z9|LEUC_WOLSU 3-isopropylmalate dehydratase large subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuC PE=3 SV=1 66 487 2.0E-36
sp|Q1AVC5|LEUC2_RUBXD 3-isopropylmalate dehydratase large subunit 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC2 PE=3 SV=1 64 481 2.0E-36
sp|P49367|LYS4_YEAST Homoaconitase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS4 PE=1 SV=1 67 721 3.0E-36
sp|B5YKE0|LEUC_THEYD 3-isopropylmalate dehydratase large subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=leuC PE=3 SV=1 65 507 4.0E-36
sp|B0KAH5|LEUC_THEP3 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=leuC PE=3 SV=1 65 481 4.0E-36
sp|Q9UT74|LYS4_SCHPO Homoaconitase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys2 PE=3 SV=1 62 507 5.0E-36
sp|B5EHU2|LEUC_GEOBB 3-isopropylmalate dehydratase large subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuC PE=3 SV=1 65 508 6.0E-36
sp|Q4JC09|LEUC_SULAC 3-isopropylmalate dehydratase large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuC PE=3 SV=1 64 508 8.0E-36
sp|Q5V518|LEUC_HALMA 3-isopropylmalate dehydratase large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=leuC PE=3 SV=1 164 508 9.0E-36
sp|A6LPX4|LEUC_CLOB8 3-isopropylmalate dehydratase large subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuC PE=3 SV=1 65 481 9.0E-36
sp|Q9RTI6|LEUC2_DEIRA 3-isopropylmalate dehydratase large subunit 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC2 PE=3 SV=1 65 508 9.0E-36
sp|Q2GN26|LYS4_CHAGB Homoaconitase, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LYS4 PE=3 SV=1 60 508 1.0E-35
sp|A3DHI4|LEUC_CLOTH 3-isopropylmalate dehydratase large subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuC PE=3 SV=1 65 507 1.0E-35
sp|B2V844|LEUC_SULSY 3-isopropylmalate dehydratase large subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=leuC PE=3 SV=1 65 508 1.0E-35
sp|P75764|YBHJ_ECOLI Uncharacterized protein YbhJ OS=Escherichia coli (strain K12) GN=ybhJ PE=3 SV=2 91 776 1.0E-35
sp|Q2LWJ2|LEUC_SYNAS 3-isopropylmalate dehydratase large subunit OS=Syntrophus aciditrophicus (strain SB) GN=leuC PE=3 SV=1 65 508 2.0E-35
sp|Q4P521|LYS4_USTMA Homoaconitase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LYS4 PE=3 SV=2 67 507 2.0E-35
sp|A7ZFP0|LEUC_CAMC1 3-isopropylmalate dehydratase large subunit OS=Campylobacter concisus (strain 13826) GN=leuC PE=3 SV=1 66 481 4.0E-35
sp|P55811|LEUC_RHINI 3-isopropylmalate dehydratase OS=Rhizopus niveus GN=LEU1 PE=3 SV=1 173 711 5.0E-35
sp|Q7ZAG7|LEUC_HALVD 3-isopropylmalate dehydratase large subunit OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuC PE=3 SV=2 67 508 5.0E-35
sp|O27439|LEUC_METTH Probable 3-isopropylmalate dehydratase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuC PE=3 SV=1 65 482 5.0E-35
sp|Q47SA3|LEUC_THEFY 3-isopropylmalate dehydratase large subunit OS=Thermobifida fusca (strain YX) GN=leuC PE=3 SV=1 173 508 6.0E-35
sp|A6Q5L6|LEUC_NITSB 3-isopropylmalate dehydratase large subunit OS=Nitratiruptor sp. (strain SB155-2) GN=leuC PE=3 SV=1 66 481 7.0E-35
sp|P55251|LEUC_RHIPU 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 173 733 7.0E-35
sp|B8DM92|LEUC_DESVM 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuC PE=3 SV=1 66 481 8.0E-35
sp|A6Q6J8|LEUC_SULNB 3-isopropylmalate dehydratase large subunit OS=Sulfurovum sp. (strain NBC37-1) GN=leuC PE=3 SV=1 66 484 9.0E-35
sp|Q4FP15|LEUC_PELUB 3-isopropylmalate dehydratase large subunit OS=Pelagibacter ubique (strain HTCC1062) GN=leuC PE=3 SV=1 64 507 1.0E-34
sp|P44968|LEUC_HAEIN 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuC PE=3 SV=2 129 507 1.0E-34
sp|Q2G958|LEUC_NOVAD 3-isopropylmalate dehydratase large subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuC PE=3 SV=1 173 508 1.0E-34
sp|P56934|LEUC_BUCAI 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuC PE=3 SV=2 170 507 1.0E-34
sp|B9L6Y8|LEUC_NAUPA 3-isopropylmalate dehydratase large subunit OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=leuC PE=3 SV=1 64 481 2.0E-34
sp|Q03UM2|LEUC_LEUMM 3-isopropylmalate dehydratase large subunit OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=leuC PE=3 SV=1 173 517 2.0E-34
sp|Q00464|LEUC_CANMA 3-isopropylmalate dehydratase OS=Candida maltosa GN=LEU1 PE=3 SV=1 141 709 3.0E-34
sp|A1VAE7|LEUC_DESVV 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuC PE=3 SV=1 66 508 3.0E-34
sp|A5FKC6|LEUC_FLAJ1 3-isopropylmalate dehydratase large subunit OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=leuC PE=3 SV=1 96 508 3.0E-34
sp|Q18AJ2|LEUC_PEPD6 3-isopropylmalate dehydratase large subunit OS=Peptoclostridium difficile (strain 630) GN=leuC PE=3 SV=1 65 481 4.0E-34
sp|A7H0L8|LEUC_CAMC5 3-isopropylmalate dehydratase large subunit OS=Campylobacter curvus (strain 525.92) GN=leuC PE=3 SV=1 96 481 4.0E-34
sp|Q7VH31|LEUC_HELHP 3-isopropylmalate dehydratase large subunit OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuC PE=3 SV=1 65 508 4.0E-34
sp|A4IRH6|LEUC_GEOTN 3-isopropylmalate dehydratase large subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuC PE=3 SV=2 172 507 4.0E-34
sp|Q9ZNE0|HACA_THET2 Homoaconitase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hacA PE=1 SV=1 162 508 5.0E-34
sp|A5UUP5|LEUC_ROSS1 3-isopropylmalate dehydratase large subunit OS=Roseiflexus sp. (strain RS-1) GN=leuC PE=3 SV=1 64 508 5.0E-34
sp|P81291|LEUC_METJA Isopropylmalate/citramalate isomerase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuC PE=1 SV=1 96 507 5.0E-34
sp|A0AK94|LEUC_LISW6 3-isopropylmalate dehydratase large subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuC PE=3 SV=1 150 489 7.0E-34
sp|A8EQZ0|LEUC_ARCB4 3-isopropylmalate dehydratase large subunit OS=Arcobacter butzleri (strain RM4018) GN=leuC PE=3 SV=1 66 481 8.0E-34
sp|A1SLW5|LEUC_NOCSJ 3-isopropylmalate dehydratase large subunit OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuC PE=3 SV=1 149 520 9.0E-34
sp|Q4QLS2|LEUC_HAEI8 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain 86-028NP) GN=leuC PE=3 SV=1 129 507 1.0E-33
sp|O04916|ACOC_SOLTU Aconitate hydratase, cytoplasmic (Fragment) OS=Solanum tuberosum PE=2 SV=1 268 777 1.0E-33
sp|B8DBU2|LEUC_LISMH 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuC PE=3 SV=1 150 489 1.0E-33
sp|Q92A26|LEUC_LISIN 3-isopropylmalate dehydratase large subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuC PE=3 SV=1 150 489 2.0E-33
sp|A5UD83|LEUC_HAEIE 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain PittEE) GN=leuC PE=3 SV=1 129 507 3.0E-33
sp|A1T700|LEUC_MYCVP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuC PE=3 SV=1 161 508 3.0E-33
sp|C1F700|LEUC_ACIC5 3-isopropylmalate dehydratase large subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=leuC PE=3 SV=1 125 508 3.0E-33
sp|A4FMP2|LEUC_SACEN 3-isopropylmalate dehydratase large subunit OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuC PE=3 SV=1 141 508 4.0E-33
sp|Q5E858|LEUC_VIBF1 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuC PE=3 SV=1 129 489 4.0E-33
sp|C5D5L8|LEUC_GEOSW 3-isopropylmalate dehydratase large subunit OS=Geobacillus sp. (strain WCH70) GN=leuC PE=3 SV=1 172 489 4.0E-33
sp|Q726X4|LEUC_DESVH 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuC PE=3 SV=1 66 508 4.0E-33
sp|B1MVR0|LEUC_LEUCK 3-isopropylmalate dehydratase large subunit OS=Leuconostoc citreum (strain KM20) GN=leuC PE=3 SV=1 147 507 5.0E-33
sp|B5FGH2|LEUC_VIBFM 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain MJ11) GN=leuC PE=3 SV=1 129 489 5.0E-33
sp|Q30NZ0|LEUC_SULDN 3-isopropylmalate dehydratase large subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuC PE=3 SV=1 66 481 5.0E-33
sp|Q8Y5R7|LEUC_LISMO 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuC PE=3 SV=1 150 489 5.0E-33
sp|B8FMM4|LEUC_DESAA 3-isopropylmalate dehydratase large subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuC PE=3 SV=1 65 481 5.0E-33
sp|A9KT79|LEUC_CLOPH 3-isopropylmalate dehydratase large subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=leuC PE=3 SV=1 65 481 5.0E-33
sp|Q65V07|LEUC2_MANSM 3-isopropylmalate dehydratase large subunit 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC2 PE=3 SV=1 129 489 6.0E-33
sp|Q6NHL0|LEUC_CORDI 3-isopropylmalate dehydratase large subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuC PE=3 SV=1 173 508 7.0E-33
sp|Q64QP1|LEUC_BACFR 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain YCH46) GN=leuC PE=3 SV=1 92 508 9.0E-33
sp|Q5LAB1|LEUC_BACFN 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuC PE=3 SV=1 92 508 9.0E-33
sp|O86534|LEUC_STRCO 3-isopropylmalate dehydratase large subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuC PE=3 SV=1 186 508 9.0E-33
sp|B9MDK8|LEUC_ACIET 3-isopropylmalate dehydratase large subunit OS=Acidovorax ebreus (strain TPSY) GN=leuC PE=3 SV=1 167 489 1.0E-32
sp|A1WAS7|LEUC_ACISJ 3-isopropylmalate dehydratase large subunit OS=Acidovorax sp. (strain JS42) GN=leuC PE=3 SV=1 167 489 1.0E-32
sp|B8F3W8|LEUC_HAEPS 3-isopropylmalate dehydratase large subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=leuC PE=3 SV=1 156 507 1.0E-32
sp|Q2IJC2|LEUC_ANADE 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuC PE=3 SV=1 147 495 1.0E-32
sp|B9LUZ3|LEUC_HALLT 3-isopropylmalate dehydratase large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=leuC PE=3 SV=1 164 508 1.0E-32
sp|Q5KWJ5|LEUC_GEOKA 3-isopropylmalate dehydratase large subunit OS=Geobacillus kaustophilus (strain HTA426) GN=leuC PE=3 SV=1 173 507 1.0E-32
sp|B7GNM7|LEUC_BIFLS 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuC PE=3 SV=1 173 508 1.0E-32
sp|Q8FPR3|LEUC_COREF 3-isopropylmalate dehydratase large subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuC PE=3 SV=1 173 508 1.0E-32
sp|Q97VY2|LEUC_SULSO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuC PE=3 SV=1 66 508 1.0E-32
sp|B0USF4|LEUC_HISS2 3-isopropylmalate dehydratase large subunit OS=Histophilus somni (strain 2336) GN=leuC PE=3 SV=1 129 489 2.0E-32
sp|Q0I2G3|LEUC_HAES1 3-isopropylmalate dehydratase large subunit OS=Haemophilus somnus (strain 129Pt) GN=leuC PE=3 SV=1 129 489 2.0E-32
sp|B4UAN0|LEUC_ANASK 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain K) GN=leuC PE=3 SV=1 147 495 2.0E-32
sp|Q89X98|LEUC1_BRADU 3-isopropylmalate dehydratase large subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC1 PE=3 SV=2 93 489 2.0E-32
sp|A7NJH2|LEUC_ROSCS 3-isopropylmalate dehydratase large subunit OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuC PE=3 SV=1 64 505 2.0E-32
sp|Q71Y33|LEUC_LISMF 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuC PE=3 SV=1 150 489 2.0E-32
sp|C1KWT3|LEUC_LISMC 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuC PE=3 SV=1 150 489 2.0E-32
sp|B9JCN5|LEUC_AGRRK 3-isopropylmalate dehydratase large subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=leuC PE=3 SV=1 61 489 2.0E-32
sp|Q6LV26|LEUC_PHOPR 3-isopropylmalate dehydratase large subunit OS=Photobacterium profundum GN=leuC PE=3 SV=2 129 489 2.0E-32
sp|Q7MP79|LEUC_VIBVY 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain YJ016) GN=leuC PE=3 SV=1 173 489 3.0E-32
sp|O14289|LEUC_SCHPO 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 64 709 3.0E-32
sp|Q3IRQ4|LEUC_NATPD 3-isopropylmalate dehydratase large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=leuC PE=3 SV=1 173 508 3.0E-32
sp|Q6FEW0|LEUC_ACIAD 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuC PE=3 SV=1 173 489 4.0E-32
sp|Q8DED9|LEUC_VIBVU 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain CMCP6) GN=leuC PE=3 SV=1 173 489 4.0E-32
sp|Q65VS0|LEUC1_MANSM 3-isopropylmalate dehydratase large subunit 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC1 PE=3 SV=1 170 507 4.0E-32
sp|B9JUD6|LEUC_AGRVS 3-isopropylmalate dehydratase large subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuC PE=3 SV=1 61 489 4.0E-32
sp|P07264|LEUC_YEAST 3-isopropylmalate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU1 PE=1 SV=3 62 722 4.0E-32
sp|A6L1V8|LEUC_BACV8 3-isopropylmalate dehydratase large subunit OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=leuC PE=3 SV=1 66 495 4.0E-32
sp|Q5YRY0|LEUC_NOCFA 3-isopropylmalate dehydratase large subunit OS=Nocardia farcinica (strain IFM 10152) GN=leuC PE=3 SV=1 161 508 5.0E-32
sp|Q2K376|LEUC_RHIEC 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuC PE=3 SV=1 61 507 5.0E-32
sp|A7HZP6|LEUC_CAMHC 3-isopropylmalate dehydratase large subunit OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuC PE=3 SV=1 66 481 5.0E-32
sp|Q1H0L4|LEUC_METFK 3-isopropylmalate dehydratase large subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuC PE=3 SV=1 173 507 6.0E-32
sp|Q2JPG2|LEUC_SYNJB 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuC PE=3 SV=1 150 507 6.0E-32
sp|B3PR22|LEUC_RHIE6 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CIAT 652) GN=leuC PE=3 SV=1 61 489 6.0E-32
sp|A1TLH6|LEUC_ACIAC 3-isopropylmalate dehydratase large subunit OS=Acidovorax citrulli (strain AAC00-1) GN=leuC PE=3 SV=1 156 489 6.0E-32
sp|Q2S0M6|LEUC_SALRD 3-isopropylmalate dehydratase large subunit OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuC PE=3 SV=1 101 508 6.0E-32
sp|A8MDY8|LEUC_CALMQ 3-isopropylmalate dehydratase large subunit OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=leuC PE=3 SV=1 144 508 6.0E-32
sp|A6VQL0|LEUC_ACTSZ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuC PE=3 SV=1 129 489 7.0E-32
sp|A1W1X0|LEUC_CAMJJ 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuC PE=3 SV=1 66 510 8.0E-32
sp|Q974R0|LEUC_SULTO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuC PE=3 SV=1 64 485 8.0E-32
sp|C5CSH5|LEUC_VARPS 3-isopropylmalate dehydratase large subunit OS=Variovorax paradoxus (strain S110) GN=leuC PE=3 SV=1 148 489 9.0E-32
sp|A3M1S8|LEUC_ACIBT 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=leuC PE=3 SV=2 136 489 9.0E-32
sp|Q4JUX2|LEUC_CORJK 3-isopropylmalate dehydratase large subunit OS=Corynebacterium jeikeium (strain K411) GN=leuC PE=3 SV=1 63 508 1.0E-31
sp|A7H665|LEUC_CAMJD 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuC PE=3 SV=1 93 510 1.0E-31
sp|Q8A6L7|LEUC_BACTN 3-isopropylmalate dehydratase large subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuC PE=3 SV=1 92 495 1.0E-31
sp|B8J825|LEUC_ANAD2 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=leuC PE=3 SV=1 147 495 1.0E-31
sp|A4TE23|LEUC_MYCGI 3-isopropylmalate dehydratase large subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuC PE=3 SV=1 173 508 1.0E-31
sp|Q74ZM9|LEUC_ASHGO 3-isopropylmalate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU1 PE=3 SV=2 165 722 1.0E-31
sp|Q1AZC4|LEUC1_RUBXD 3-isopropylmalate dehydratase large subunit 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC1 PE=3 SV=1 170 508 1.0E-31
sp|A4YF03|LEUC_METS5 3-isopropylmalate dehydratase large subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuC PE=3 SV=1 66 508 1.0E-31
sp|B5ENJ1|LEUC_ACIF5 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=leuC PE=3 SV=1 148 489 1.0E-31
sp|B7J5E0|LEUC_ACIF2 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=leuC PE=3 SV=1 148 489 1.0E-31
sp|B7I4E1|LEUC_ACIB5 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB0057) GN=leuC PE=3 SV=1 136 489 2.0E-31
sp|Q8F4E6|LEUC_LEPIN 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuC PE=3 SV=1 167 507 2.0E-31
sp|Q72RC4|LEUC_LEPIC 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuC PE=3 SV=1 167 507 2.0E-31
sp|Q82JR8|LEUC_STRAW 3-isopropylmalate dehydratase large subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuC PE=3 SV=1 186 508 2.0E-31
sp|B7GH21|LEUC_ANOFW 3-isopropylmalate dehydratase large subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuC PE=3 SV=1 170 489 2.0E-31
sp|Q393X2|LEUC_BURL3 3-isopropylmalate dehydratase large subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuC PE=3 SV=1 173 489 2.0E-31
sp|Q67MJ2|LEUC_SYMTH 3-isopropylmalate dehydratase large subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuC PE=3 SV=1 167 489 2.0E-31
sp|B2HII1|LEUC_MYCMM 3-isopropylmalate dehydratase large subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuC PE=3 SV=1 161 508 2.0E-31
sp|B1MDQ1|LEUC_MYCA9 3-isopropylmalate dehydratase large subunit OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=leuC PE=3 SV=1 173 508 2.0E-31
sp|Q3IJS4|LEUC_PSEHT 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuC PE=3 SV=1 140 489 2.0E-31
sp|B7H0T7|LEUC_ACIB3 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB307-0294) GN=leuC PE=3 SV=1 136 489 2.0E-31
sp|B8HAC9|LEUC_ARTCA 3-isopropylmalate dehydratase large subunit OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=leuC PE=3 SV=1 148 508 3.0E-31
sp|Q9K8F0|LEUC_BACHD 3-isopropylmalate dehydratase large subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuC PE=3 SV=1 147 507 3.0E-31
sp|Q87SS9|LEUC_VIBPA 3-isopropylmalate dehydratase large subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuC PE=3 SV=1 173 489 3.0E-31
sp|Q9EVH7|LEUC_BUCUH 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuC PE=3 SV=1 170 481 3.0E-31
sp|Q0VPI0|LEUC_ALCBS 3-isopropylmalate dehydratase large subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuC PE=3 SV=2 162 489 4.0E-31
sp|Q0BAC8|LEUC_BURCM 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuC PE=3 SV=1 173 489 4.0E-31
sp|B1Z1N0|LEUC_BURA4 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain MC40-6) GN=leuC PE=3 SV=1 173 489 4.0E-31
sp|A7MWC3|LEUC_VIBCB 3-isopropylmalate dehydratase large subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuC PE=3 SV=1 173 489 4.0E-31
sp|B0BS44|LEUC_ACTPJ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuC PE=3 SV=1 129 489 4.0E-31
sp|O85072|LEUC_BUCDN 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuC PE=3 SV=1 170 511 4.0E-31
sp|Q6AFK7|LEUC_LEIXX 3-isopropylmalate dehydratase large subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuC PE=3 SV=1 64 508 4.0E-31
sp|Q8UBY9|LEUC_AGRFC 3-isopropylmalate dehydratase large subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuC PE=3 SV=2 61 489 4.0E-31
sp|B1VZ03|LEUC_STRGG 3-isopropylmalate dehydratase large subunit OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuC PE=3 SV=1 186 508 4.0E-31
sp|Q0A9B0|LEUC_ALKEH 3-isopropylmalate dehydratase large subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuC PE=3 SV=1 172 489 5.0E-31
sp|A1WY14|LEUC_HALHL 3-isopropylmalate dehydratase large subunit OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuC PE=3 SV=1 165 489 6.0E-31
sp|Q9PLW1|LEUC_CAMJE 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuC PE=3 SV=1 66 510 6.0E-31
sp|Q73B98|LEUC_BACC1 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuC PE=3 SV=1 172 507 6.0E-31
sp|A0ZZS7|LEUC_BIFAA 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=leuC PE=3 SV=1 186 489 6.0E-31
sp|A0JXX8|LEUC_ARTS2 3-isopropylmalate dehydratase large subunit OS=Arthrobacter sp. (strain FB24) GN=leuC PE=3 SV=1 173 508 6.0E-31
sp|Q2RV55|LEUC_RHORT 3-isopropylmalate dehydratase large subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuC PE=3 SV=1 61 508 6.0E-31
sp|B3GZY1|LEUC_ACTP7 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuC PE=3 SV=1 129 489 6.0E-31
sp|A3MYL1|LEUC_ACTP2 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuC PE=3 SV=1 129 489 6.0E-31
sp|A1R7K0|LEUC_ARTAT 3-isopropylmalate dehydratase large subunit OS=Arthrobacter aurescens (strain TC1) GN=leuC PE=3 SV=1 173 508 7.0E-31
sp|Q1MAJ9|LEUC_RHIL3 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuC PE=3 SV=1 61 489 8.0E-31
sp|A1AW36|LEUC_RUTMC 3-isopropylmalate dehydratase large subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuC PE=3 SV=2 173 489 8.0E-31
sp|B5ZTI5|LEUC_RHILW 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuC PE=3 SV=1 61 489 8.0E-31
sp|Q6NH63|ACNA_CORDI Aconitate hydratase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=acn PE=3 SV=1 123 357 8.0E-31
sp|Q126M9|LEUC_POLSJ 3-isopropylmalate dehydratase large subunit OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuC PE=3 SV=1 167 489 8.0E-31
sp|Q9RTY9|LEUC1_DEIRA 3-isopropylmalate dehydratase large subunit 1 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC1 PE=3 SV=1 147 509 8.0E-31
sp|B2I359|LEUC_ACIBC 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ACICU) GN=leuC PE=3 SV=1 136 489 9.0E-31
sp|Q0RDK7|LEUC_FRAAA 3-isopropylmalate dehydratase large subunit OS=Frankia alni (strain ACN14a) GN=leuC PE=3 SV=1 161 508 9.0E-31
sp|Q5HS78|LEUC_CAMJR 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni (strain RM1221) GN=leuC PE=3 SV=1 66 510 9.0E-31
sp|A0AZ60|LEUC_BURCH 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain HI2424) GN=leuC PE=3 SV=1 173 489 1.0E-30
sp|B1K377|LEUC_BURCC 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain MC0-3) GN=leuC PE=3 SV=1 173 489 1.0E-30
sp|Q1BM55|LEUC_BURCA 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain AU 1054) GN=leuC PE=3 SV=1 173 489 1.0E-30
sp|A8FP33|LEUC_CAMJ8 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuC PE=3 SV=1 66 510 1.0E-30
sp|B6ELJ8|LEUC_ALISL 3-isopropylmalate dehydratase large subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=leuC PE=3 SV=1 70 489 1.0E-30
sp|A5G0G6|LEUC_ACICJ 3-isopropylmalate dehydratase large subunit OS=Acidiphilium cryptum (strain JF-5) GN=leuC PE=3 SV=1 173 508 1.0E-30
sp|A0RBL4|LEUC_BACAH 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=leuC PE=3 SV=1 172 507 1.0E-30
sp|Q7NUB6|LEUC_CHRVO 3-isopropylmalate dehydratase large subunit OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuC PE=3 SV=1 167 507 2.0E-30
sp|Q8G4W2|LEUC_BIFLO 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain NCC 2705) GN=leuC PE=3 SV=1 173 489 2.0E-30
sp|B3DPI2|LEUC_BIFLD 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain DJO10A) GN=leuC PE=3 SV=1 173 489 2.0E-30
sp|Q0HE67|LEUC_SHESM 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-4) GN=leuC PE=3 SV=1 64 489 2.0E-30
sp|Q2T7H8|LEUC_BURTA 3-isopropylmalate dehydratase large subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuC PE=3 SV=1 173 489 2.0E-30
sp|B2JQE1|LEUC_BURP8 3-isopropylmalate dehydratase large subunit OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuC PE=3 SV=1 173 489 2.0E-30
sp|Q8NQ98|ACNA_CORGL Aconitate hydratase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acn PE=1 SV=2 91 373 2.0E-30
sp|P17279|LEUC_MUCCL 3-isopropylmalate dehydratase OS=Mucor circinelloides f. lusitanicus GN=LEUA PE=3 SV=1 165 508 2.0E-30
sp|A0PPZ6|LEUC_MYCUA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium ulcerans (strain Agy99) GN=leuC PE=3 SV=1 161 508 2.0E-30
sp|Q7VQJ8|LEUC_BLOFL 3-isopropylmalate dehydratase large subunit OS=Blochmannia floridanus GN=leuC PE=3 SV=1 122 489 2.0E-30
sp|A4JMB6|LEUC_BURVG 3-isopropylmalate dehydratase large subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuC PE=3 SV=1 173 489 2.0E-30
sp|A1K4A1|LEUC_AZOSB 3-isopropylmalate dehydratase large subunit OS=Azoarcus sp. (strain BH72) GN=leuC PE=3 SV=1 173 508 3.0E-30
sp|Q8TQZ3|LEUC_METAC Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuC PE=3 SV=1 65 508 3.0E-30
sp|Q73VI7|LEUC_MYCPA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuC PE=3 SV=1 161 508 3.0E-30
sp|Q9EVI0|LEUC_BUCUO 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuC PE=3 SV=1 129 489 3.0E-30
sp|A4G4F5|LEUC_HERAR 3-isopropylmalate dehydratase large subunit OS=Herminiimonas arsenicoxydans GN=leuC PE=3 SV=1 162 507 3.0E-30
sp|A4SWW8|LEUC_POLSQ 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuC PE=3 SV=1 173 489 3.0E-30
sp|Q21IY3|LEUC_SACD2 3-isopropylmalate dehydratase large subunit OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuC PE=3 SV=1 173 489 3.0E-30
sp|B1H0A6|LEUC_UNCTG 3-isopropylmalate dehydratase large subunit OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=leuC PE=3 SV=1 66 508 3.0E-30
sp|A6T015|LEUC_JANMA 3-isopropylmalate dehydratase large subunit OS=Janthinobacterium sp. (strain Marseille) GN=leuC PE=3 SV=1 162 507 3.0E-30
sp|A6W7Q7|LEUC_KINRD 3-isopropylmalate dehydratase large subunit OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuC PE=3 SV=1 173 508 3.0E-30
sp|A0QJB7|LEUC_MYCA1 3-isopropylmalate dehydratase large subunit OS=Mycobacterium avium (strain 104) GN=leuC PE=3 SV=1 161 508 3.0E-30
sp|Q46YV7|LEUC_CUPPJ 3-isopropylmalate dehydratase large subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuC PE=3 SV=1 173 489 3.0E-30
sp|A0L1Q8|LEUC_SHESA 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain ANA-3) GN=leuC PE=3 SV=1 64 489 4.0E-30
sp|Q2VZV4|LEUC_MAGSA 3-isopropylmalate dehydratase large subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuC PE=3 SV=1 66 508 4.0E-30
sp|Q2J6W9|LEUC_FRASC 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain CcI3) GN=leuC PE=3 SV=1 161 508 4.0E-30
sp|Q5WEN5|LEUC_BACSK 3-isopropylmalate dehydratase large subunit OS=Bacillus clausii (strain KSM-K16) GN=leuC PE=3 SV=1 147 507 4.0E-30
sp|A0RMG7|LEUC_CAMFF 3-isopropylmalate dehydratase large subunit OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuC PE=3 SV=1 66 481 4.0E-30
sp|Q493R2|LEUC_BLOPB 3-isopropylmalate dehydratase large subunit OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuC PE=3 SV=1 140 507 4.0E-30
sp|Q2SJD8|LEUC_HAHCH 3-isopropylmalate dehydratase large subunit OS=Hahella chejuensis (strain KCTC 2396) GN=leuC PE=3 SV=1 173 489 5.0E-30
sp|B9IUZ2|LEUC_BACCQ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain Q1) GN=leuC PE=3 SV=1 172 489 5.0E-30
sp|B7HKC6|LEUC_BACC7 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH187) GN=leuC PE=3 SV=1 172 489 5.0E-30
sp|C1EMB1|LEUC_BACC3 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain 03BB102) GN=leuC PE=3 SV=1 172 507 5.0E-30
sp|A4Y2M2|LEUC_SHEPC 3-isopropylmalate dehydratase large subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuC PE=3 SV=1 96 489 6.0E-30
sp|Q9AQC6|LEUC_BUCUL 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuC PE=3 SV=1 170 481 6.0E-30
sp|O31293|LEUC_BUCTS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuC PE=3 SV=1 173 505 6.0E-30
sp|P9WQF5|LEUC_MYCTU 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuC PE=1 SV=1 161 508 7.0E-30
sp|P9WQF4|LEUC_MYCTO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuC PE=3 SV=1 161 508 7.0E-30
sp|A5U6Z9|LEUC_MYCTA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuC PE=3 SV=1 161 508 7.0E-30
sp|Q5P1J8|LEUC_AROAE 3-isopropylmalate dehydratase large subunit OS=Aromatoleum aromaticum (strain EbN1) GN=leuC PE=3 SV=1 173 489 7.0E-30
sp|C1AGA3|LEUC_MYCBT 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuC PE=3 SV=1 161 508 7.0E-30
sp|A1KMY2|LEUC_MYCBP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuC PE=3 SV=1 161 508 7.0E-30
sp|Q7TXH6|LEUC_MYCBO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuC PE=1 SV=1 161 508 7.0E-30
sp|A3PXR2|LEUC_MYCSJ 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain JLS) GN=leuC PE=3 SV=1 161 508 7.0E-30
sp|Q0HZT2|LEUC_SHESR 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-7) GN=leuC PE=3 SV=1 96 489 7.0E-30
sp|Q8XXX3|LEUC_RALSO 3-isopropylmalate dehydratase large subunit OS=Ralstonia solanacearum (strain GMI1000) GN=leuC PE=3 SV=1 173 489 7.0E-30
sp|Q7N127|LEUC_PHOLL 3-isopropylmalate dehydratase large subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuC PE=3 SV=1 129 489 7.0E-30
sp|Q11CQ6|LEUC_CHESB 3-isopropylmalate dehydratase large subunit OS=Chelativorans sp. (strain BNC1) GN=leuC PE=3 SV=1 64 489 7.0E-30
sp|Q1BAQ4|LEUC_MYCSS 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain MCS) GN=leuC PE=3 SV=1 161 508 8.0E-30
sp|A1UEA8|LEUC_MYCSK 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain KMS) GN=leuC PE=3 SV=1 161 508 8.0E-30
sp|Q8ZW41|LEUC_PYRAE 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuC PE=3 SV=1 66 481 9.0E-30
sp|A0L8J4|LEUC_MAGMM 3-isopropylmalate dehydratase large subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuC PE=3 SV=1 137 489 1.0E-29
sp|C1DD59|LEUC_LARHH 3-isopropylmalate dehydratase large subunit OS=Laribacter hongkongensis (strain HLHK9) GN=leuC PE=3 SV=1 136 489 1.0E-29
sp|B7JFY7|LEUC_BACC0 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH820) GN=leuC PE=3 SV=1 172 507 1.0E-29
sp|Q81T66|LEUC_BACAN 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis GN=leuC PE=3 SV=1 172 507 1.0E-29
sp|C3L9Q5|LEUC_BACAC 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuC PE=3 SV=1 172 507 1.0E-29
sp|C3P4Z8|LEUC_BACAA 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain A0248) GN=leuC PE=3 SV=1 172 507 1.0E-29
sp|Q8PUG1|LEUC_METMA Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuC PE=3 SV=2 65 508 1.0E-29
sp|A9VLG9|LEUC_BACWK 3-isopropylmalate dehydratase large subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuC PE=3 SV=1 172 507 1.0E-29
sp|Q9EVG8|LEUC_BUCUM 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuC PE=3 SV=2 170 489 1.0E-29
sp|B1XV55|LEUC_POLNS 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuC PE=3 SV=1 173 489 1.0E-29
sp|Q326G3|LEUC_SHIBS 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=leuC PE=3 SV=1 129 508 1.0E-29
sp|Q63DX6|LEUC_BACCZ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ZK / E33L) GN=leuC PE=3 SV=1 172 507 1.0E-29
sp|Q3SHL1|LEUC_THIDA 3-isopropylmalate dehydratase large subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuC PE=3 SV=1 173 489 1.0E-29
sp|Q47WG2|LEUC_COLP3 3-isopropylmalate dehydratase large subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuC PE=3 SV=1 156 507 1.0E-29
sp|Q65GJ0|LEUC_BACLD 3-isopropylmalate dehydratase large subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuC PE=3 SV=1 172 507 2.0E-29
sp|A9LZF7|LEUC_NEIM0 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C (strain 053442) GN=leuC PE=3 SV=1 167 508 2.0E-29
sp|Q6HLF1|LEUC_BACHK 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuC PE=3 SV=1 172 507 2.0E-29
sp|A7GMU3|LEUC_BACCN 3-isopropylmalate dehydratase large subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuC PE=3 SV=1 173 489 2.0E-29
sp|Q2JQU3|LEUC_SYNJA 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuC PE=3 SV=1 150 507 2.0E-29
sp|A1UZ32|LEUC_BURMS 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain SAVP1) GN=leuC PE=3 SV=1 172 489 3.0E-29
sp|Q62AI6|LEUC_BURMA 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain ATCC 23344) GN=leuC PE=3 SV=1 172 489 3.0E-29
sp|A2S127|LEUC_BURM9 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10229) GN=leuC PE=3 SV=1 172 489 3.0E-29
sp|A3MBT5|LEUC_BURM7 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10247) GN=leuC PE=3 SV=1 172 489 3.0E-29
sp|A1KU80|LEUC_NEIMF 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuC PE=3 SV=1 167 508 3.0E-29
sp|Q3Z5T8|LEUC_SHISS 3-isopropylmalate dehydratase large subunit OS=Shigella sonnei (strain Ss046) GN=leuC PE=3 SV=1 129 489 3.0E-29
sp|Q63JK9|LEUC_BURPS 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain K96243) GN=leuC PE=3 SV=1 173 489 3.0E-29
sp|A3NM77|LEUC_BURP6 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 668) GN=leuC PE=3 SV=1 173 489 3.0E-29
sp|Q3JKG6|LEUC_BURP1 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1710b) GN=leuC PE=3 SV=2 173 489 3.0E-29
sp|A3P7N9|LEUC_BURP0 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1106a) GN=leuC PE=3 SV=1 173 489 3.0E-29
sp|Q92L76|LEUC_RHIME 3-isopropylmalate dehydratase large subunit OS=Rhizobium meliloti (strain 1021) GN=leuC PE=3 SV=1 61 491 3.0E-29
sp|P58945|LEUC_BUCPS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuC PE=3 SV=1 170 495 3.0E-29
sp|C3M9V0|LEUC_RHISN 3-isopropylmalate dehydratase large subunit OS=Rhizobium sp. (strain NGR234) GN=leuC PE=3 SV=1 61 489 3.0E-29
sp|P49601|LEUC_USTMA 3-isopropylmalate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEU1 PE=3 SV=1 64 508 3.0E-29
sp|B4F196|LEUC_PROMH 3-isopropylmalate dehydratase large subunit OS=Proteus mirabilis (strain HI4320) GN=leuC PE=3 SV=1 170 489 3.0E-29
sp|A1U0Y0|LEUC_MARHV 3-isopropylmalate dehydratase large subunit OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=leuC PE=3 SV=1 172 489 3.0E-29
sp|Q8E9N4|LEUC_SHEON 3-isopropylmalate dehydratase large subunit OS=Shewanella oneidensis (strain MR-1) GN=leuC PE=3 SV=1 170 489 3.0E-29
sp|A1REY2|LEUC_SHESW 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain W3-18-1) GN=leuC PE=3 SV=1 96 489 4.0E-29
sp|Q9JU82|LEUC_NEIMA 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuC PE=3 SV=1 167 508 4.0E-29
sp|B7IN95|LEUC_BACC2 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain G9842) GN=leuC PE=3 SV=1 172 507 4.0E-29
sp|A8L567|LEUC_FRASN 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain EAN1pec) GN=leuC PE=3 SV=1 170 508 4.0E-29
sp|Q9EVH4|LEUC_BUCUE 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuC PE=3 SV=1 170 489 4.0E-29
sp|A0KGM7|LEUC_AERHH 3-isopropylmalate dehydratase large subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuC PE=3 SV=1 47 508 4.0E-29
sp|A4WMI6|LEUC_PYRAR 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuC PE=3 SV=1 91 481 4.0E-29
sp|P58946|LEUC_CORGL 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuC PE=2 SV=1 173 508 4.0E-29
sp|Q8FYG9|LEUC_BRUSU 3-isopropylmalate dehydratase large subunit OS=Brucella suis biovar 1 (strain 1330) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|B0CIF7|LEUC_BRUSI 3-isopropylmalate dehydratase large subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|A5VSN3|LEUC_BRUO2 3-isopropylmalate dehydratase large subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|A9M8P2|LEUC_BRUC2 3-isopropylmalate dehydratase large subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|Q57AZ0|LEUC_BRUAB 3-isopropylmalate dehydratase large subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|Q2YLP7|LEUC_BRUA2 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain 2308) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|B2S860|LEUC_BRUA1 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain S19) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|Q1QAF2|LEUC_PSYCK 3-isopropylmalate dehydratase large subunit OS=Psychrobacter cryohalolentis (strain K5) GN=leuC PE=3 SV=1 173 489 5.0E-29
sp|Q81G10|LEUC_BACCR 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuC PE=3 SV=1 172 507 5.0E-29
sp|Q8YJC9|LEUC_BRUME 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|C0RFF1|LEUC_BRUMB 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuC PE=3 SV=1 61 489 5.0E-29
sp|A7HT10|LEUC_PARL1 3-isopropylmalate dehydratase large subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuC PE=3 SV=1 64 508 5.0E-29
sp|A4QDS8|LEUC_CORGB 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain R) GN=leuC PE=3 SV=1 173 508 5.0E-29
sp|Q9EVI6|LEUC_BUCUN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuC PE=3 SV=1 170 489 6.0E-29
sp|B8DVN0|LEUC_BIFA0 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=leuC PE=3 SV=1 173 489 6.0E-29
sp|Q44427|LEUC_ACTTI 3-isopropylmalate dehydratase large subunit OS=Actinoplanes teichomyceticus GN=leuC PE=3 SV=1 173 508 6.0E-29
sp|Q821C2|LEUC_SHIFL 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri GN=leuC PE=3 SV=1 129 489 7.0E-29
sp|A4X4C8|LEUC_SALTO 3-isopropylmalate dehydratase large subunit OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=leuC PE=3 SV=1 148 508 8.0E-29
sp|Q938C9|LEUC_MYCS2 3-isopropylmalate dehydratase large subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=leuC PE=3 SV=1 163 508 8.0E-29
sp|B7UIC2|LEUC_ECO27 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuC PE=3 SV=1 129 508 8.0E-29
sp|B7KRK4|LEUC_METC4 3-isopropylmalate dehydratase large subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=leuC PE=3 SV=1 70 507 9.0E-29
sp|B2U279|LEUC_SHIB3 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|Q1RGC5|LEUC_ECOUT 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|B1LG09|LEUC_ECOSM 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|B6HZ52|LEUC_ECOSE 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SE11) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|P0A6A6|LEUC_ECOLI 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12) GN=leuC PE=1 SV=2 129 508 9.0E-29
sp|P0A6A7|LEUC_ECOL6 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuC PE=3 SV=2 129 508 9.0E-29
sp|Q0TLR7|LEUC_ECOL5 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|A1A7C0|LEUC_ECOK1 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O1:K1 / APEC GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|C4ZPZ5|LEUC_ECOBW 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|B7M117|LEUC_ECO8A 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O8 (strain IAI1) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|B7MNT0|LEUC_ECO81 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O81 (strain ED1a) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|B7NHI0|LEUC_ECO7I 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|B7MAJ7|LEUC_ECO45 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuC PE=3 SV=1 129 508 9.0E-29
sp|Q8CNL1|LEUC_STAES 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuC PE=3 SV=1 163 507 1.0E-28
sp|B7L4J3|LEUC_ECO55 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain 55989 / EAEC) GN=leuC PE=3 SV=1 129 489 1.0E-28
sp|B7N7U7|LEUC_ECOLU 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuC PE=3 SV=1 129 489 1.0E-28
sp|B4RM67|LEUC_NEIG2 3-isopropylmalate dehydratase large subunit OS=Neisseria gonorrhoeae (strain NCCP11945) GN=leuC PE=3 SV=1 167 508 1.0E-28
sp|Q4WBR0|ACON3_ASPFU Putative aconitate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoC PE=2 SV=1 129 728 1.0E-28
sp|A1VRR0|LEUC_POLNA 3-isopropylmalate dehydratase large subunit OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuC PE=3 SV=1 167 489 1.0E-28
sp|Q9JZI5|LEUC_NEIMB 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuC PE=3 SV=1 167 508 1.0E-28
sp|B1YD98|LEUC_PYRNV 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuC PE=3 SV=1 91 481 1.0E-28
sp|Q6D0G6|LEUC_PECAS 3-isopropylmalate dehydratase large subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuC PE=3 SV=1 129 508 1.0E-28
sp|A7ZHG4|LEUC_ECO24 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuC PE=3 SV=1 129 489 1.0E-28
sp|B7LWE0|LEUC_ESCF3 3-isopropylmalate dehydratase large subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuC PE=3 SV=1 129 489 1.0E-28
sp|B1IRA6|LEUC_ECOLC 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuC PE=3 SV=1 129 508 1.0E-28
sp|A7ZW23|LEUC_ECOHS 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O9:H4 (strain HS) GN=leuC PE=3 SV=1 129 508 1.0E-28
sp|A6WXG4|LEUC_OCHA4 3-isopropylmalate dehydratase large subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuC PE=3 SV=1 61 489 1.0E-28
sp|Q01Z81|LEUC_SOLUE 3-isopropylmalate dehydratase large subunit OS=Solibacter usitatus (strain Ellin6076) GN=leuC PE=3 SV=1 165 505 1.0E-28
sp|O33123|LEUC_MYCLE 3-isopropylmalate dehydratase large subunit OS=Mycobacterium leprae (strain TN) GN=leuC PE=3 SV=1 186 508 2.0E-28
sp|Q3M614|LEUC_ANAVT 3-isopropylmalate dehydratase large subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuC PE=3 SV=1 167 508 2.0E-28
sp|B7HHF7|LEUC_BACC4 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain B4264) GN=leuC PE=3 SV=1 172 507 2.0E-28
sp|Q0AT09|LEUC_MARMM 3-isopropylmalate dehydratase large subunit OS=Maricaulis maris (strain MCS10) GN=leuC PE=3 SV=1 154 482 2.0E-28
sp|A7Z7B6|LEUC_BACMF 3-isopropylmalate dehydratase large subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuC PE=3 SV=1 173 507 2.0E-28
sp|Q0T8C6|LEUC_SHIF8 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=leuC PE=3 SV=1 129 489 2.0E-28
sp|Q32K22|LEUC_SHIDS 3-isopropylmalate dehydratase large subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuC PE=3 SV=1 129 489 2.0E-28
sp|C6DEW0|LEUC_PECCP 3-isopropylmalate dehydratase large subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuC PE=3 SV=1 129 508 2.0E-28
sp|A9KY15|LEUC_SHEB9 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS195) GN=leuC PE=3 SV=1 96 489 2.0E-28
sp|A6WIB7|LEUC_SHEB8 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS185) GN=leuC PE=3 SV=1 96 489 2.0E-28
sp|A6UE05|LEUC_SINMW 3-isopropylmalate dehydratase large subunit OS=Sinorhizobium medicae (strain WSM419) GN=leuC PE=3 SV=1 61 491 2.0E-28
sp|Q5F8T1|LEUC_NEIG1 3-isopropylmalate dehydratase large subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuC PE=3 SV=1 167 508 2.0E-28
sp|A7HBI2|LEUC_ANADF 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=leuC PE=3 SV=1 147 482 2.0E-28
sp|Q89X34|LEUC2_BRADU 3-isopropylmalate dehydratase large subunit 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC2 PE=3 SV=1 61 489 2.0E-28
sp|Q1ICW0|LEUC_PSEE4 3-isopropylmalate dehydratase large subunit OS=Pseudomonas entomophila (strain L48) GN=leuC PE=3 SV=1 67 489 3.0E-28
sp|Q7VDT0|LEUC_PROMA 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuC PE=3 SV=1 125 508 3.0E-28
sp|A7MIC7|LEUC_CROS8 3-isopropylmalate dehydratase large subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuC PE=3 SV=1 129 508 3.0E-28
sp|B1LXK9|LEUC_METRJ 3-isopropylmalate dehydratase large subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=leuC PE=3 SV=1 68 507 3.0E-28
sp|Q0BRH4|LEUC_GRABC 3-isopropylmalate dehydratase large subunit OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuC PE=3 SV=1 172 508 3.0E-28
sp|A3CZK7|LEUC_SHEB5 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuC PE=3 SV=1 96 489 3.0E-28
sp|Q11NN8|LEUC_CYTH3 3-isopropylmalate dehydratase large subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=leuC PE=3 SV=1 139 507 3.0E-28
sp|A8G2R6|LEUC_PROM2 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=leuC PE=3 SV=1 163 508 3.0E-28
sp|A5WGT5|LEUC_PSYWF 3-isopropylmalate dehydratase large subunit OS=Psychrobacter sp. (strain PRwf-1) GN=leuC PE=3 SV=1 173 489 4.0E-28
sp|B7KH96|LEUC_CYAP7 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7424) GN=leuC PE=3 SV=1 140 508 4.0E-28
sp|B0KF81|LEUC_PSEPG 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain GB-1) GN=leuC PE=3 SV=1 123 489 5.0E-28
sp|B8E4K6|LEUC_SHEB2 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS223) GN=leuC PE=3 SV=1 96 489 5.0E-28
sp|A1JJH5|LEUC_YERE8 3-isopropylmalate dehydratase large subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuC PE=3 SV=1 129 508 5.0E-28
sp|B3PFN2|LEUC_CELJU 3-isopropylmalate dehydratase large subunit OS=Cellvibrio japonicus (strain Ueda107) GN=leuC PE=3 SV=1 173 510 5.0E-28
sp|Q9EVI3|LEUC_BUCUS 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuC PE=3 SV=1 170 481 5.0E-28
sp|O59391|LEUC_PYRHO 3-isopropylmalate dehydratase large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuC PE=3 SV=1 65 508 5.0E-28
sp|Q8YX02|LEUC_NOSS1 3-isopropylmalate dehydratase large subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuC PE=3 SV=1 167 508 5.0E-28
sp|A8M5I3|LEUC_SALAI 3-isopropylmalate dehydratase large subunit OS=Salinispora arenicola (strain CNS-205) GN=leuC PE=3 SV=1 148 508 6.0E-28
sp|B1JKA0|LEUC_YERPY 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|A4TQA4|LEUC_YERPP 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis (strain Pestoides F) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|Q1CMP7|LEUC_YERPN 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|A9R144|LEUC_YERPG 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|Q8ZIH0|LEUC_YERPE 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|Q1C1Z4|LEUC_YERPA 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|A7FM86|LEUC_YERP3 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|Q98EF1|LEUC_RHILO 3-isopropylmalate dehydratase large subunit OS=Rhizobium loti (strain MAFF303099) GN=leuC PE=3 SV=1 61 489 6.0E-28
sp|Q66EM3|LEUC_YERPS 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|B2K4C7|LEUC_YERPB 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuC PE=3 SV=1 129 508 6.0E-28
sp|B5YZA8|LEUC_ECO5E 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuC PE=3 SV=1 129 489 7.0E-28
sp|Q8XA00|LEUC_ECO57 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 GN=leuC PE=3 SV=3 129 489 7.0E-28
sp|B8EN95|LEUC_METSB 3-isopropylmalate dehydratase large subunit OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=leuC PE=3 SV=1 61 489 8.0E-28
sp|Q8TW29|LEUC2_METKA 3-isopropylmalate dehydratase large subunit 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC2 PE=3 SV=1 67 504 8.0E-28
sp|A6T4L7|LEUC_KLEP7 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuC PE=3 SV=1 129 489 9.0E-28
sp|Q5HMF7|LEUC_STAEQ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuC PE=3 SV=1 163 507 1.0E-27
sp|Q4L7U2|LEUC_STAHJ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuC PE=3 SV=1 162 507 1.0E-27
sp|B1ZKX6|LEUC_METPB 3-isopropylmalate dehydratase large subunit OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=leuC PE=3 SV=1 70 507 1.0E-27
sp|Q5FUG3|LEUC_GLUOX 3-isopropylmalate dehydratase large subunit OS=Gluconobacter oxydans (strain 621H) GN=leuC PE=3 SV=1 161 507 1.0E-27
sp|A0LVA3|LEUC_ACIC1 3-isopropylmalate dehydratase large subunit OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuC PE=3 SV=1 161 508 1.0E-27
sp|B5Y1W4|LEUC_KLEP3 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae (strain 342) GN=leuC PE=3 SV=1 129 489 1.0E-27
sp|B7K213|LEUC_CYAP8 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 8801) GN=leuC PE=3 SV=1 164 508 2.0E-27
sp|A8FFW3|LEUC_BACP2 3-isopropylmalate dehydratase large subunit OS=Bacillus pumilus (strain SAFR-032) GN=leuC PE=3 SV=1 172 507 2.0E-27
sp|C3LR34|LEUC_VIBCM 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=leuC PE=3 SV=1 173 489 2.0E-27
sp|Q9KP81|LEUC_VIBCH 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuC PE=3 SV=1 173 489 2.0E-27
sp|A5F5E2|LEUC_VIBC3 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=leuC PE=3 SV=1 173 489 2.0E-27
sp|A6V2V3|LEUC_PSEA7 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain PA7) GN=leuC PE=3 SV=1 173 507 2.0E-27
sp|Q31HI2|LEUC_THICR 3-isopropylmalate dehydratase large subunit OS=Thiomicrospira crunogena (strain XCL-2) GN=leuC PE=3 SV=1 162 507 2.0E-27
sp|Q4FRU7|LEUC_PSYA2 3-isopropylmalate dehydratase large subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuC PE=3 SV=1 173 489 2.0E-27
sp|B1XLQ6|LEUC_SYNP2 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuC PE=3 SV=1 129 508 2.0E-27
sp|Q7W931|LEUC_BORPA 3-isopropylmalate dehydratase large subunit OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuC PE=3 SV=2 154 489 2.0E-27
sp|Q7WKH6|LEUC_BORBR 3-isopropylmalate dehydratase large subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuC PE=3 SV=2 154 489 2.0E-27
sp|A3QIN8|LEUC_SHELP 3-isopropylmalate dehydratase large subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuC PE=3 SV=1 70 489 2.0E-27
sp|Q7VY75|LEUC_BORPE 3-isopropylmalate dehydratase large subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuC PE=3 SV=1 154 489 2.0E-27
sp|B1HR96|LEUC_LYSSC 3-isopropylmalate dehydratase large subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=leuC PE=3 SV=1 156 495 3.0E-27
sp|Q9HZA3|LEUC_PSEAE 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuC PE=3 SV=1 173 507 3.0E-27
sp|Q02PT4|LEUC_PSEAB 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=leuC PE=3 SV=1 173 507 3.0E-27
sp|B7VBP9|LEUC_PSEA8 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain LESB58) GN=leuC PE=3 SV=1 173 507 3.0E-27
sp|Q8NQ98|ACNA_CORGL Aconitate hydratase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acn PE=1 SV=2 379 777 2.0E-17
sp|Q6NH63|ACNA_CORDI Aconitate hydratase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=acn PE=3 SV=1 379 777 6.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031530
MYNLTHRSTHAARVAKRMAAGVATAATRIGDTKVAMSAFEKDSFINYQRIEDNLAVVRNRLKRPLTLSEKVVYGH
LDDPHGQDINRGVSYLKLRPDRVACHDATAQMALLQFMSVSMDTAAAPTTIHCDHLIEAQIGGVKDLQRAVQTNK
EVYDFLATVTAKYGLGFWKPGSGIIHQILLEHYAFPGGMMVGTDSHSPNAGGLGMVACGVGGADAVDVMAGIPWE
LKCPKVIGVNLTGKIGGWTTPKDVILKVAGILTVKGGTGAIVEYKGPGVESLSCTGMATICNMGAEIGATTSLFP
FNRRMADYLQATKRSDVANYAKAFAHNLQADEAAEYDEHIEINLSELEPHINGPFTPDLATPISKFASEAKKNGW
PEEVKVGLIGSCTNSSYEDMTRSASIVKQAADRGIDFKSKFTVTPGSEQVRATIARDGLIDSFESAGAIVLANAC
GPCIGQWDRQDVKKGEVNSIVTSYNRNFTGRNDANPATHAFVASPDITTALAFAGRLSFNPLTDELIGSDGKPFK
FSDPSGNELPPRGYDPGEDTFQPPPQDRASVQVAIDPKSDRLQVLTPFKPWDGKTPSDLPVLIKVKGKCTTDHIS
AGGPWLKYRGHLENISQNCLIGAINAENGEANKIKNQITGEYDGVPQTAAYYRERGIKWVVIGDHNYGEGSSREH
AALEPRFLGGLAIVARSFARIHETNLKKQGMLALTFIDPADYDKVRPDDKVDILGLEAFSPGRNLTLVAKHTDGT
QDEISLAHSFNEGQIEWFKAGSALNLIAAKAKSA*
Coding >AgabiH97|031530
ATGTACAACCTTACTCACAGGTCCACCCATGCCGCCCGCGTCGCGAAGCGCATGGCTGCGGGTGTGGCCACCGCA
GCTACACGTATCGGTGACACCAAAGTCGCCATGTCCGCCTTTGAAAAGGACTCGTTTATTAACTACCAGCGCATC
GAGGATAACCTTGCCGTTGTTCGTAACAGGCTGAAACGCCCCTTGACATTGTCTGAAAAGGTTGTCTATGGACAT
CTTGATGATCCCCATGGTCAGGACATCAACCGCGGTGTCAGCTATCTTAAACTACGTCCAGACCGTGTTGCCTGC
CATGACGCTACAGCACAGATGGCCTTGCTCCAATTCATGTCTGTTAGTATGGATACGGCCGCCGCTCCCACCACC
ATACACTGTGACCATCTCATCGAGGCCCAGATTGGTGGTGTCAAGGATCTACAGCGCGCTGTTCAAACGAACAAG
GAAGTTTACGATTTTCTTGCTACTGTCACGGCAAAATACGGGCTCGGGTTTTGGAAACCAGGTTCTGGTATTATT
CATCAGATTCTTCTCGAACACTATGCGTTCCCTGGTGGCATGATGGTTGGTACGGACTCGCATTCGCCCAACGCT
GGTGGTCTCGGCATGGTCGCTTGTGGTGTTGGCGGTGCCGACGCTGTCGATGTGATGGCCGGTATACCTTGGGAG
CTTAAATGTCCCAAAGTCATTGGTGTTAACCTCACTGGAAAGATTGGCGGCTGGACTACTCCAAAGGATGTCATT
CTCAAGGTTGCGGGTATCCTCACCGTCAAGGGTGGAACTGGCGCCATCGTTGAATATAAGGGCCCCGGTGTCGAG
TCTCTTTCTTGCACGGGTATGGCGACTATTTGCAACATGGGTGCGGAAATAGGGGCAACGACATCTCTGTTCCCG
TTCAATCGCCGCATGGCCGACTATCTACAAGCCACTAAACGGTCTGATGTCGCAAATTACGCCAAGGCCTTTGCG
CACAACCTGCAAGCCGATGAGGCGGCCGAGTACGATGAGCATATCGAGATCAATCTTTCCGAGCTTGAGCCTCAC
ATCAACGGACCATTCACACCTGATTTGGCCACTCCTATCTCCAAGTTCGCGTCGGAGGCCAAGAAGAATGGCTGG
CCCGAAGAAGTCAAAGTTGGTCTCATCGGTTCCTGCACTAACTCGTCATACGAGGATATGACTCGCTCTGCATCT
ATCGTGAAGCAAGCTGCCGACCGCGGTATTGATTTCAAGAGCAAATTCACGGTTACCCCTGGATCCGAGCAAGTT
CGTGCCACGATTGCTCGTGATGGCCTCATCGACTCTTTCGAAAGTGCTGGCGCAATAGTTCTGGCCAATGCCTGT
GGTCCTTGCATCGGTCAGTGGGATAGGCAGGATGTCAAGAAGGGTGAAGTCAACTCCATCGTAACTTCTTACAAC
CGCAATTTCACTGGTCGTAATGATGCGAACCCTGCTACGCATGCCTTTGTTGCCTCTCCCGACATCACCACTGCT
CTCGCGTTTGCTGGCCGCCTCAGCTTCAACCCGCTCACGGATGAGCTCATTGGCAGCGATGGCAAGCCATTCAAG
TTCTCAGATCCCAGTGGCAATGAGTTGCCTCCCCGTGGCTATGATCCCGGAGAGGACACCTTCCAACCCCCTCCT
CAAGACCGCGCTAGCGTTCAGGTTGCCATTGACCCGAAGTCTGATCGTCTCCAAGTCCTGACACCCTTCAAGCCT
TGGGATGGCAAGACCCCCAGTGATCTTCCCGTTCTCATCAAGGTCAAGGGCAAATGCACAACCGATCACATCTCT
GCCGGTGGTCCGTGGTTGAAGTACCGTGGACATCTGGAGAACATCTCTCAGAACTGTCTGATTGGTGCCATCAAC
GCGGAGAACGGAGAAGCTAACAAGATCAAGAACCAGATCACAGGAGAGTACGACGGTGTTCCGCAAACTGCTGCA
TACTATCGTGAACGTGGGATCAAATGGGTCGTCATCGGTGACCACAACTATGGAGAAGGTTCTTCTCGTGAACAT
GCTGCACTGGAGCCCCGCTTCCTTGGTGGCCTTGCCATCGTTGCTCGTTCCTTCGCTCGCATCCACGAGACGAAC
TTGAAGAAGCAGGGTATGCTTGCTTTGACCTTTATCGATCCTGCCGACTATGATAAAGTTCGTCCCGATGACAAG
GTTGATATCCTTGGTCTCGAGGCCTTCTCTCCCGGAAGAAATTTGACGTTGGTGGCTAAGCACACTGATGGTACT
CAAGATGAAATCTCGCTCGCACATTCATTCAATGAGGGTCAGATTGAATGGTTCAAGGCTGGTTCTGCTTTGAAC
CTCATAGCAGCCAAAGCTAAGTCGGCATAA
Transcript >AgabiH97|031530
ATGTACAACCTTACTCACAGGTCCACCCATGCCGCCCGCGTCGCGAAGCGCATGGCTGCGGGTGTGGCCACCGCA
GCTACACGTATCGGTGACACCAAAGTCGCCATGTCCGCCTTTGAAAAGGACTCGTTTATTAACTACCAGCGCATC
GAGGATAACCTTGCCGTTGTTCGTAACAGGCTGAAACGCCCCTTGACATTGTCTGAAAAGGTTGTCTATGGACAT
CTTGATGATCCCCATGGTCAGGACATCAACCGCGGTGTCAGCTATCTTAAACTACGTCCAGACCGTGTTGCCTGC
CATGACGCTACAGCACAGATGGCCTTGCTCCAATTCATGTCTGTTAGTATGGATACGGCCGCCGCTCCCACCACC
ATACACTGTGACCATCTCATCGAGGCCCAGATTGGTGGTGTCAAGGATCTACAGCGCGCTGTTCAAACGAACAAG
GAAGTTTACGATTTTCTTGCTACTGTCACGGCAAAATACGGGCTCGGGTTTTGGAAACCAGGTTCTGGTATTATT
CATCAGATTCTTCTCGAACACTATGCGTTCCCTGGTGGCATGATGGTTGGTACGGACTCGCATTCGCCCAACGCT
GGTGGTCTCGGCATGGTCGCTTGTGGTGTTGGCGGTGCCGACGCTGTCGATGTGATGGCCGGTATACCTTGGGAG
CTTAAATGTCCCAAAGTCATTGGTGTTAACCTCACTGGAAAGATTGGCGGCTGGACTACTCCAAAGGATGTCATT
CTCAAGGTTGCGGGTATCCTCACCGTCAAGGGTGGAACTGGCGCCATCGTTGAATATAAGGGCCCCGGTGTCGAG
TCTCTTTCTTGCACGGGTATGGCGACTATTTGCAACATGGGTGCGGAAATAGGGGCAACGACATCTCTGTTCCCG
TTCAATCGCCGCATGGCCGACTATCTACAAGCCACTAAACGGTCTGATGTCGCAAATTACGCCAAGGCCTTTGCG
CACAACCTGCAAGCCGATGAGGCGGCCGAGTACGATGAGCATATCGAGATCAATCTTTCCGAGCTTGAGCCTCAC
ATCAACGGACCATTCACACCTGATTTGGCCACTCCTATCTCCAAGTTCGCGTCGGAGGCCAAGAAGAATGGCTGG
CCCGAAGAAGTCAAAGTTGGTCTCATCGGTTCCTGCACTAACTCGTCATACGAGGATATGACTCGCTCTGCATCT
ATCGTGAAGCAAGCTGCCGACCGCGGTATTGATTTCAAGAGCAAATTCACGGTTACCCCTGGATCCGAGCAAGTT
CGTGCCACGATTGCTCGTGATGGCCTCATCGACTCTTTCGAAAGTGCTGGCGCAATAGTTCTGGCCAATGCCTGT
GGTCCTTGCATCGGTCAGTGGGATAGGCAGGATGTCAAGAAGGGTGAAGTCAACTCCATCGTAACTTCTTACAAC
CGCAATTTCACTGGTCGTAATGATGCGAACCCTGCTACGCATGCCTTTGTTGCCTCTCCCGACATCACCACTGCT
CTCGCGTTTGCTGGCCGCCTCAGCTTCAACCCGCTCACGGATGAGCTCATTGGCAGCGATGGCAAGCCATTCAAG
TTCTCAGATCCCAGTGGCAATGAGTTGCCTCCCCGTGGCTATGATCCCGGAGAGGACACCTTCCAACCCCCTCCT
CAAGACCGCGCTAGCGTTCAGGTTGCCATTGACCCGAAGTCTGATCGTCTCCAAGTCCTGACACCCTTCAAGCCT
TGGGATGGCAAGACCCCCAGTGATCTTCCCGTTCTCATCAAGGTCAAGGGCAAATGCACAACCGATCACATCTCT
GCCGGTGGTCCGTGGTTGAAGTACCGTGGACATCTGGAGAACATCTCTCAGAACTGTCTGATTGGTGCCATCAAC
GCGGAGAACGGAGAAGCTAACAAGATCAAGAACCAGATCACAGGAGAGTACGACGGTGTTCCGCAAACTGCTGCA
TACTATCGTGAACGTGGGATCAAATGGGTCGTCATCGGTGACCACAACTATGGAGAAGGTTCTTCTCGTGAACAT
GCTGCACTGGAGCCCCGCTTCCTTGGTGGCCTTGCCATCGTTGCTCGTTCCTTCGCTCGCATCCACGAGACGAAC
TTGAAGAAGCAGGGTATGCTTGCTTTGACCTTTATCGATCCTGCCGACTATGATAAAGTTCGTCCCGATGACAAG
GTTGATATCCTTGGTCTCGAGGCCTTCTCTCCCGGAAGAAATTTGACGTTGGTGGCTAAGCACACTGATGGTACT
CAAGATGAAATCTCGCTCGCACATTCATTCAATGAGGGTCAGATTGAATGGTTCAAGGCTGGTTCTGCTTTGAAC
CTCATAGCAGCCAAAGCTAAGTCGGCATAA
Gene >AgabiH97|031530
ATGTACAACCTTACTCACAGGTCCACCCATGCCGCCCGCGTCGCGAAGCGCATGGCTGCGGGTGTGGCCACCGCA
GCTACACGTATCGGTGACACCAAAGTCGCCATGTCCGCCTTTGAAAAGGACTCGTTTATTAACTACCAGCGCATC
GAGGATAACCTTGCCGTTGTTCGTAACAGGTTTGTCTGCCCCATACTCCTGCATTCGCATTGCTAATGCACTTTA
AGGCTGAAACGCCCCTTGACATTGTCTGAAAAGGTTGTCTATGGACATCTTGATGATCCCCATGGTCAGGACATC
AACCGCGGTGTCAGCTATCTTAAACTACGTCCAGACGTATGTACTACCGTGGCCATTGTCCTCGCGTCAGGTTCT
GAATCTGCTTTCCTCCGCATAGCGTGTTGCCTGCCATGACGCTACAGCACAGGTTTCAGCCTCAGTGTCGCTCTA
AGTGACGTATAGTGATATATCTCTAGATGGCCTTGCTCCAATTCATGTCTGTTAGTATGGATACGGCCGCCGCTC
CCACCACCATACACTGTGACCATCTCATCGAGGCCCAGATTGGTGGTGTCAAGGATCTACAGCGCGCTGTTCAAA
CGAACAAGGAAGTTTACGATTTTCTTGCTACTGTCACGGCAAAATACGGGCTCGGGTTTTGGAAACCAGGTTCTG
GTATTATTCATCAGATTCTTCTCGAACACTATGCGTTCCCTGGTGGCATGATGGTTGGTACGGACTCGCATTCGC
CCAACGCTGGTGGTCTCGGCATGGTCGCTTGTGGTGTTGGCGGTGCCGACGCTGTCGATGTGATGGCCGGTATAC
CTTGGGAGCTTAAATGTCCCAAAGTCATTGGTGTTAACCTCACTGGAAAGATTGGCGGCTGGACTACTCCAAAGG
GTTGGTGACCTTGCATTCGGGTCTGTTGCTTCTCTAACATCATGCTACAGATGTCATTCTCAAGGTTGCGGGTAT
CCTCACCGTCAAGGGTGGAACTGGCGCCATCGTTGAATATAAGGGCCCCGGTGTCGAGTCTCTTTCTTGCACGGG
TATGGCGACTATTTGCAACATGGGTGCGGAAATAGGGGCAACGACATCTCTGTTCCCGTTCAATCGCCGCATGGC
CGACTATCTACAAGCCACTAAACGGTCTGATGTCGCAAATTACGCCAAGGCCTTTGCGCACAACCTGCAAGCCGA
TGAGGCGGCCGAGTACGATGAGCATATCGAGATCGTGAGTGTCGCAGGGAATGTCTTGACACTCAGTCTAACGCT
TTCCTAGAATCTTTCCGAGCTTGAGCCTCACATCAACGGACCATTCACACCTGATTTGGCCACTCCTATCTCCAA
GTTCGCGTCGGAGGCCAAGAAGAATGGCTGGCCCGAAGAAGTCAAAGTTGGTCTCATCGGTTCCTGCACTAACTC
GTCATACGAGGATATGACTCGCTCTGCATCTATCGTGAAGCAAGCTGCCGACCGCGGTATTGATTTCAAGAGCAA
ATTCACGGTTACCCCTGGATCCGAGCAAGTTCGTGCCACGATTGCTCGTGATGGCCTCATCGACTCTTTCGAAAG
TGCTGGCGCAATAGTTCTGGCCAATGCCTGTGGTCCTTGCATCGGTCAGTGGGATAGGCAGGATGTCAAGAAGGG
TGAAGTCAACTCCAGTGAGTAGTTGGTGTTTTTCATAACGAAGGGATTCGCCTGACGACATTCTTTATAGTCGTA
ACTTCTTACAACCGCAATTTCACTGGTCGTAATGATGCGAACCCTGCTACGCATGCCTTTGTTGCCTCTCCCGAC
ATCACCACTGCTCTCGCGTTTGCTGGCCGCCTCAGCTTCAACCCGCTCACGGATGAGCTCATTGGCAGCGATGGC
AAGCCATTCAAGTTCTCAGATCCCAGTGGCAATGAGTTGCCTCCCCGTGGCTATGATCCCGGAGAGGACACCTTC
CAACCCCCTCCTCAAGACCGCGCTAGCGTTCAGGTTGCCATTGACCCGAAGTCTGATCGTCTCCAAGTCCTGACA
CCCTTCAAGCCTTGGGATGGCAAGACCCCCAGTGATCTTCCCGTTCTCATCAAGGTCAAGGGCAAATGCACAACC
GATCACATCTCTGCCGGTGGTCCGTGGTTGAAGTACCGTGGACATCTGGAGAACATCTCTCAGAACTGTCTGATT
GGTGCCATCAACGCGGAGAACGGAGAAGCTAACAAGATCAAGAACCAGATCACAGGAGAGTACGACGGTGTTCCG
CAAACTGCTGCATACTATCGTGAACGTGGGATCAAATGGGTCGTCATCGGTGACCACAACTATGGAGAAGGTTCT
TCTCGTGAACATGCTGCACTGGAGCCCCGCTTCCTTGGTGGCCTTGCCATCGTTGCTCGTTCCTTCGCTCGCATC
CACGAGACGAACTTGAAGAAGCAGGGTATGCTTGCTTTGACCTTTATCGATCCTGCCGACTATGATAAAGTTCGT
CCCGATGACAAGGTTGATATCCTTGGTCTCGAGGCCTTCTCTCCCGGAAGAAATTTGACGTTGGTGGCTAAGCAC
ACTGATGGTACTCAAGATGTAAGTGTGGTTTCAGATGGCTTTCAATGATGTATCTCATTTTCATGTCAGGAAATC
TCGCTCGCACATTCATTCAATGAGGGTCAGATTGAATGGTTCAAGGCTGGTTCTGCTTTGAACCTCATAGCAGCC
AAAGCTAAGTCGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail