Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031520
Gene name
Locationscaffold_12:919322..921835
Strand-
Gene length (bp)2513
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125) 3.0E-152 84 493

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10449|MU157_SCHPO Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug157 PE=1 SV=1 33 509 9.0E-137

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031520
MGLLNVIFGLMKLNAKSIVLALTGLAVHSTAQCPDYTGYSQEPQGDPSNGPLGLPFMRPAPACRTFNSTAVEKVI
SDMKTLLKDPDIARLFENTFPNTLDTTVRYYSQEENLAFIITGVSIAQWLRDTANQFAHYGTLLGQDPELAQLVK
AVINNEARYVSQYPYCGSFQPPPESGLAPSHNDWADGVTVNPPVDNQTVFECKYELDSLCGFLKLSRLYYTNTKD
TSFMNDNWRTAIDQIFRVINEQSQATFDKDFNFISFYNWTGGNGALSPMVPNRGNGEPKAFTGLVGTHHRPSDDL
SVFAFLTPANAMLSVELTHLAEILDQTNELKNVSQQAKEWSSRIHKAIWDTTVVDDIFAYETNGFGGRYVMDDAN
IPSLISLPYLGFLEKKNPAYVATRKQLLSAKNPYFAAGKKFQGVGGPHVDPWHPWPMSQIAAIFGTDDDEEILKS
LYLVVNNTAGLGLIHESQSIYDEKDYTRSWFAWANSFFAEMVLDLADRKPSLVLKRNESYRPGLNL*
Coding >AgabiH97|031520
ATGGGTCTGCTGAATGTCATCTTTGGTCTCATGAAATTGAACGCAAAAAGCATAGTGCTTGCCTTGACTGGCCTA
GCCGTCCACTCCACCGCGCAATGTCCGGATTATACGGGATATTCACAAGAACCCCAGGGAGATCCTTCTAACGGA
CCATTGGGCCTACCTTTCATGCGACCTGCTCCAGCTTGTCGGACATTTAACAGCACAGCTGTCGAGAAAGTTATC
AGTGACATGAAAACGTTGCTGAAAGACCCAGACATCGCTCGATTGTTTGAGAATACCTTCCCGAACACACTAGAT
ACAACTGTCAGGTACTATAGCCAAGAAGAAAACCTCGCTTTCATTATCACTGGAGTAAGCATTGCCCAATGGCTG
CGTGACACTGCCAATCAGTTTGCTCACTATGGTACACTCCTTGGGCAAGACCCGGAGCTGGCGCAGCTCGTTAAG
GCTGTCATCAATAACGAAGCCCGTTACGTCTCGCAGTACCCGTACTGTGGTTCATTCCAACCTCCTCCAGAAAGT
GGTCTAGCTCCTTCGCACAATGACTGGGCGGATGGCGTAACTGTGAACCCGCCTGTGGACAATCAAACTGTGTTC
GAATGCAAATATGAACTTGACTCCCTATGTGGCTTTCTCAAGCTCTCGCGCCTTTACTACACGAATACCAAGGAT
ACATCCTTCATGAATGATAACTGGCGCACGGCTATTGACCAGATCTTCAGAGTCATCAATGAACAGTCGCAAGCT
ACATTCGATAAAGACTTCAACTTTATCTCGTTCTACAACTGGACTGGCGGGAATGGCGCCTTGTCACCTATGGTG
CCCAATCGAGGAAACGGGGAGCCCAAAGCATTTACAGGCTTAGTAGGCACTCATCATCGGCCTTCTGATGATTTG
AGTGTCTTTGCCTTCTTGACACCGGCGAACGCAATGCTCAGTGTCGAATTAACACACCTCGCTGAAATATTGGAT
CAGACCAACGAGCTCAAGAATGTCAGCCAACAGGCGAAGGAATGGAGCTCCCGGATACATAAGGCTATTTGGGAC
ACGACGGTAGTCGATGACATATTTGCGTACGAGACAAATGGATTTGGCGGCAGATACGTCATGGACGATGCAAAT
ATTCCATCTTTGATTTCTCTCCCATATCTGGGGTTCCTTGAGAAAAAGAATCCCGCTTATGTAGCCACCCGAAAG
CAGCTATTATCTGCAAAGAATCCCTACTTTGCTGCGGGTAAAAAGTTCCAAGGTGTTGGAGGGCCTCACGTTGAT
CCGTGGCATCCCTGGCCCATGTCCCAGATCGCGGCCATTTTTGGCACCGACGACGATGAAGAAATTCTCAAATCC
TTGTACTTGGTAGTCAACAACACGGCAGGTCTTGGTCTAATACACGAGTCACAATCGATCTATGACGAGAAGGAT
TATACTCGAAGTTGGTTTGCGTGGGCCAACAGCTTTTTTGCGGAGATGGTGTTAGATTTGGCGGATCGGAAGCCA
AGCCTAGTGTTGAAACGGAATGAAAGCTACCGGCCTGGTTTGAATTTGTGA
Transcript >AgabiH97|031520
ATGGGTCTGCTGAATGTCATCTTTGGTCTCATGAAATTGAACGCAAAAAGCATAGTGCTTGCCTTGACTGGCCTA
GCCGTCCACTCCACCGCGCAATGTCCGGATTATACGGGATATTCACAAGAACCCCAGGGAGATCCTTCTAACGGA
CCATTGGGCCTACCTTTCATGCGACCTGCTCCAGCTTGTCGGACATTTAACAGCACAGCTGTCGAGAAAGTTATC
AGTGACATGAAAACGTTGCTGAAAGACCCAGACATCGCTCGATTGTTTGAGAATACCTTCCCGAACACACTAGAT
ACAACTGTCAGGTACTATAGCCAAGAAGAAAACCTCGCTTTCATTATCACTGGAGTAAGCATTGCCCAATGGCTG
CGTGACACTGCCAATCAGTTTGCTCACTATGGTACACTCCTTGGGCAAGACCCGGAGCTGGCGCAGCTCGTTAAG
GCTGTCATCAATAACGAAGCCCGTTACGTCTCGCAGTACCCGTACTGTGGTTCATTCCAACCTCCTCCAGAAAGT
GGTCTAGCTCCTTCGCACAATGACTGGGCGGATGGCGTAACTGTGAACCCGCCTGTGGACAATCAAACTGTGTTC
GAATGCAAATATGAACTTGACTCCCTATGTGGCTTTCTCAAGCTCTCGCGCCTTTACTACACGAATACCAAGGAT
ACATCCTTCATGAATGATAACTGGCGCACGGCTATTGACCAGATCTTCAGAGTCATCAATGAACAGTCGCAAGCT
ACATTCGATAAAGACTTCAACTTTATCTCGTTCTACAACTGGACTGGCGGGAATGGCGCCTTGTCACCTATGGTG
CCCAATCGAGGAAACGGGGAGCCCAAAGCATTTACAGGCTTAGTAGGCACTCATCATCGGCCTTCTGATGATTTG
AGTGTCTTTGCCTTCTTGACACCGGCGAACGCAATGCTCAGTGTCGAATTAACACACCTCGCTGAAATATTGGAT
CAGACCAACGAGCTCAAGAATGTCAGCCAACAGGCGAAGGAATGGAGCTCCCGGATACATAAGGCTATTTGGGAC
ACGACGGTAGTCGATGACATATTTGCGTACGAGACAAATGGATTTGGCGGCAGATACGTCATGGACGATGCAAAT
ATTCCATCTTTGATTTCTCTCCCATATCTGGGGTTCCTTGAGAAAAAGAATCCCGCTTATGTAGCCACCCGAAAG
CAGCTATTATCTGCAAAGAATCCCTACTTTGCTGCGGGTAAAAAGTTCCAAGGTGTTGGAGGGCCTCACGTTGAT
CCGTGGCATCCCTGGCCCATGTCCCAGATCGCGGCCATTTTTGGCACCGACGACGATGAAGAAATTCTCAAATCC
TTGTACTTGGTAGTCAACAACACGGCAGGTCTTGGTCTAATACACGAGTCACAATCGATCTATGACGAGAAGGAT
TATACTCGAAGTTGGTTTGCGTGGGCCAACAGCTTTTTTGCGGAGATGGTGTTAGATTTGGCGGATCGGAAGCCA
AGCCTAGTGTTGAAACGGAATGAAAGCTACCGGCCTGGTTTGAATTTGTGA
Gene >AgabiH97|031520
ATGGGTCTGCTGAATGTCATCTTTGGTCTCATGAAATTGAACGCAAAAAGCATAGTGCTTGCCTTGACTGGCCTA
GCCGTCCACTCCACCGCGCAATGTCCGGATTATACGGGATATTCACAAGTGAGTATCGTTTCCGTGTTATATTTC
CTCTTATTTACAGTCAACGCACCCTCTAGGAACCCCAGGGAGATCCTTCTAACGGACCATTGGGCCTACCTTTCA
TGCGACCTGCTCCAGCTTGTCGGACATTTAACAGCACAGCTGTCGAGGTGGGTAATTGTATTCTTACTCTATCCG
AACACTCATATAGATGACAATGTAGAAAGTTATCAGTGACATGAAAACGTTGCTGAAAGACCCAGACATCGCTCG
ATTGTTTGAGAATACCTTCCCGAACACACTAGGTATCTTGTCAAATTCACAAGCGTTTATGCGTAATTGACGAGA
TGCAAGATACAACTGTCAGGTACTATAGCCAAGTAAGCTTATTCCCGTGGCGCGTGGCGGAGTCTTACTATGTTA
TCTTCCGTCGCAGGAAGAAAACCTCGCTTTCATTATCACTGGAGTAAGCATGTTCCATGTCTCTAGAATATACAT
TAACCAACTCCTTCTTCCAGGACATAACGTACGTGATTTCACTCAATAAGTAACGTATGGCAATTGAACATATTG
TAGTGCCCAATGGCTGCGTGACACTGCCAATCAGGTTTGTTGCCCATCTACAATCTATGTTATGTTCCCTCACCT
ACGCCACGCAGTTTGCTCACTATGGTACACTCCTTGGGCAAGACCCGGAGCTGGCGCAGCTCGTTAAGGCTGTCA
TCAATAACGAAGCCCGTTACGTCTCGCAGTACCCGTACTGTGAGTAGCTATCTTTGCTACCCTGCTTTTCATCTA
TAGCTGAACCTATTAGGTGGTTCATTCCAACCTCCTCCAGAAAGTGGTCTAGCTCCTTCGCACAATGACTGGGCG
GATGGCGTAACTGTGAACCCGTAGGTATCTATTATGGATCATAGAAATGAAGCTCAACGAATGAGGTAGGCCTGT
GGACAATCAAACTGTGTTCGAATGCAAAGTAAAACATCTCCATGGCAAATCACTATCTTGAAATGCTTACCATTC
ACACGACTAGTATGAACTTGACTCCCTATGTGGCTTTCTCAAGCTCTCGCGCCTTTACTACACGAATACCAAGGA
TACATCCTTCATGAATGATAACTGTATGAACAACCTTTTCTTTCATGAGGCTCCGCATTGATAAACCATGATTAA
TCCAGGGCGCACGGCTATTGACCAGATCTTCAGAGTCATCAATGAACAGTCGCAAGCTACATTCGATAAAGACTT
CAACTTTATCTCGTTCTACAACTGGACTGGCGGGAATGGCGCCTTGTCACCTATGGTGCCCAATCGAGGAAACGG
GGAGCCCAAAGCATTTACAGGCTTAGTAGGCACTCATCATCGGCCTTCTGATGATTTGAGTGTCTTTGGTAAGTA
ATGGCATTCTGGAGAACTCTTCAAGATGAAAACTCCTTTTAGCCTTCTTGACACCGGCGAACGCAATGCTCAGTG
TCGAATTAACACACCTCGCTGAAATATTGGATCAGACCAACGAGCTCAAGAATGTCAGCCAACAGGCGAAGGAAT
GGAGCTCCCGGATACATAAGGCTATTTGGGACACGACGGTAAGGCCCCGACAATATATTCTGCGCGTAGTAAATT
CACTGACACGCTCATCAACAGGTAGTCGATGACATATTTGCGTACGAGACAAATGGTAAATTCGGTAATTCTAAC
TATGAGAGGCGAGGACTGAAAGCAAATGCCTGTAGGATTTGGCGGCAGATACGTCATGGACGATGCAAATATTCC
AGTAAGAAATACTTCTCTAACTTAATTATGGCTGAAGAACTGACCGTCTTTGGAGTCTTTGATTTCTCTCCCATA
TCTGGGGTTCCTTGAGAAAAAGAATCCCGCTTATGTAGCCACCCGAAAGCAGCTATTATCTGCAAAGAATCCCTA
CTTTGCTGCGGGTAAAAAGTTCCAAGGTGTTGGGTGCGTCGTGGTCGAAAATGTATCCTCCTTGATTCTGCCCAT
TAACTGAACCACCGTAGAGGGCCTCACGTTGATCCGTGGCATCCCTGGTATGGGTACTTCAGCTCGGTGGAAGTC
TGAATCTGACATATCTGCCTAGGCCCATGTCCCAGATCGCGGCCATTTTTGGCACCGACGACGATGAAGAAATTC
TCAAATCCTTGTACTTGGTAGTCAACGTAAGAATGATTTGTTCGTCTCAAGCCGAAACGTGGTCCTGATTATTTG
CTTAGAACACGGCAGGTCTTGGTCTAATACACGAGTCACAATCGATCTATGACGAGAAGGATTATACTCGAAGTT
GGTTTGCGTGGGCCAACAGCTTTTTTGCGGAGATGGTGTTAGATTTGGCGGATCGGAAGCCAAGCCTAGTGTTGA
AACGGAATGAAAGCTACCGGCCTGGTTTGAATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail