Protein ID | AgabiH97|031470 |
Gene name | |
Location | scaffold_12:908973..911695 |
Strand | - |
Gene length (bp) | 2722 |
Transcript length (bp) | 2355 |
Coding sequence length (bp) | 2355 |
Protein length (aa) | 785 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00330 | Aconitase | Aconitase family (aconitate hydratase) | 5.4E-158 | 69 | 505 |
PF00694 | Aconitase_C | Aconitase C-terminal domain | 1.3E-44 | 585 | 713 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|C8VG90|ACON_EMENI | Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 | 21 | 781 | 0.0E+00 |
sp|O13966|ACON_SCHPO | Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.06c PE=3 SV=2 | 23 | 778 | 0.0E+00 |
sp|Q4WLN1|ACON_ASPFU | Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 | 31 | 781 | 0.0E+00 |
sp|D4AT77|ACON_ARTBC | Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 | 12 | 782 | 0.0E+00 |
sp|P82611|ACON_CANAL | Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 | 8 | 780 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|C8VG90|ACON_EMENI | Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 | 21 | 781 | 0.0E+00 |
sp|O13966|ACON_SCHPO | Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.06c PE=3 SV=2 | 23 | 778 | 0.0E+00 |
sp|Q4WLN1|ACON_ASPFU | Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 | 31 | 781 | 0.0E+00 |
sp|D4AT77|ACON_ARTBC | Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 | 12 | 782 | 0.0E+00 |
sp|P82611|ACON_CANAL | Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 | 8 | 780 | 0.0E+00 |
sp|P19414|ACON_YEAST | Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2 | 11 | 782 | 0.0E+00 |
sp|P20004|ACON_BOVIN | Aconitate hydratase, mitochondrial OS=Bos taurus GN=ACO2 PE=1 SV=4 | 33 | 777 | 0.0E+00 |
sp|P34455|ACON_CAEEL | Probable aconitate hydratase, mitochondrial OS=Caenorhabditis elegans GN=aco-2 PE=3 SV=2 | 32 | 777 | 0.0E+00 |
sp|Q54XS2|ACON_DICDI | Probable aconitate hydratase, mitochondrial OS=Dictyostelium discoideum GN=aco2 PE=3 SV=1 | 32 | 782 | 0.0E+00 |
sp|Q9ER34|ACON_RAT | Aconitate hydratase, mitochondrial OS=Rattus norvegicus GN=Aco2 PE=1 SV=2 | 33 | 777 | 0.0E+00 |
sp|Q99798|ACON_HUMAN | Aconitate hydratase, mitochondrial OS=Homo sapiens GN=ACO2 PE=1 SV=2 | 33 | 777 | 0.0E+00 |
sp|Q99KI0|ACON_MOUSE | Aconitate hydratase, mitochondrial OS=Mus musculus GN=Aco2 PE=1 SV=1 | 33 | 777 | 0.0E+00 |
sp|P16276|ACON_PIG | Aconitate hydratase, mitochondrial OS=Sus scrofa GN=ACO2 PE=1 SV=1 | 33 | 777 | 0.0E+00 |
sp|P49609|ACON_GRAGA | Aconitate hydratase, mitochondrial OS=Gracilaria gracilis PE=3 SV=1 | 47 | 775 | 0.0E+00 |
sp|Q9P7D4|ACON2_SCHPO | Homocitrate dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.15 PE=3 SV=3 | 16 | 783 | 0.0E+00 |
sp|P39533|ACON2_YEAST | Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO2 PE=1 SV=1 | 47 | 777 | 0.0E+00 |
sp|Q4WJ90|ACON2_ASPFU | Putative aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoB PE=2 SV=1 | 47 | 781 | 0.0E+00 |
sp|Q5B6D6|ACON2_EMENI | Putative aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoB PE=3 SV=1 | 47 | 780 | 0.0E+00 |
sp|Q5SMF6|ACNA_THET8 | Aconitate hydratase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acoA PE=3 SV=1 | 93 | 775 | 2.0E-62 |
sp|Q1RKD5|ACNA_RICBR | Aconitate hydratase A OS=Rickettsia bellii (strain RML369-C) GN=acnA PE=3 SV=1 | 91 | 783 | 2.0E-62 |
sp|Q94A28|ACO3M_ARATH | Aconitate hydratase 3, mitochondrial OS=Arabidopsis thaliana GN=ACO3 PE=2 SV=3 | 91 | 711 | 6.0E-61 |
sp|Q42560|ACO1_ARATH | Aconitate hydratase 1 OS=Arabidopsis thaliana GN=ACO1 PE=1 SV=2 | 91 | 711 | 9.0E-61 |
sp|P49608|ACOC_CUCMA | Aconitate hydratase, cytoplasmic OS=Cucurbita maxima PE=2 SV=1 | 91 | 774 | 4.0E-60 |
sp|Q6YZX6|ACOC_ORYSJ | Putative aconitate hydratase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os08g0191100 PE=3 SV=1 | 91 | 720 | 7.0E-59 |
sp|Q68VV0|ACNA_RICTY | Aconitate hydratase A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=acnA PE=3 SV=1 | 91 | 782 | 1.0E-58 |
sp|Q9ZCF4|ACNA_RICPR | Aconitate hydratase A OS=Rickettsia prowazekii (strain Madrid E) GN=acnA PE=3 SV=1 | 91 | 782 | 6.0E-58 |
sp|Q937N8|ACNA_CUPNE | Aconitate hydratase A OS=Cupriavidus necator GN=acnM PE=1 SV=1 | 95 | 776 | 7.0E-58 |
sp|P70920|ACNA_BRADU | Aconitate hydratase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acnA PE=2 SV=2 | 91 | 780 | 9.0E-58 |
sp|P09339|ACNA_BACSU | Aconitate hydratase A OS=Bacillus subtilis (strain 168) GN=citB PE=1 SV=4 | 93 | 777 | 1.0E-57 |
sp|Q4UK20|ACNA_RICFE | Aconitate hydratase A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=acnA PE=3 SV=1 | 91 | 782 | 9.0E-57 |
sp|Q8EJW3|ACND_SHEON | 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) OS=Shewanella oneidensis (strain MR-1) GN=acnD PE=1 SV=1 | 95 | 778 | 1.0E-56 |
sp|Q9SIB9|ACO2M_ARATH | Aconitate hydratase 2, mitochondrial OS=Arabidopsis thaliana GN=ACO2 PE=1 SV=2 | 91 | 720 | 3.0E-56 |
sp|Q92G90|ACNA_RICCN | Aconitate hydratase A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=acnA PE=3 SV=1 | 91 | 782 | 2.0E-55 |
sp|Q42669|ACOC_CUCMC | Aconitate hydratase (Fragment) OS=Cucumis melo var. conomon GN=ACO PE=2 SV=1 | 141 | 720 | 1.0E-53 |
sp|Q59938|ACNA_STRMU | Aconitate hydratase A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=acn PE=3 SV=2 | 49 | 713 | 4.0E-53 |
sp|P63434|ACNA_STAAW | Aconitate hydratase A OS=Staphylococcus aureus (strain MW2) GN=acnA PE=3 SV=1 | 81 | 777 | 3.0E-52 |
sp|Q6G9K9|ACNA_STAAS | Aconitate hydratase A OS=Staphylococcus aureus (strain MSSA476) GN=acnA PE=3 SV=1 | 81 | 777 | 3.0E-52 |
sp|P99148|ACNA_STAAN | Aconitate hydratase A OS=Staphylococcus aureus (strain N315) GN=acnA PE=1 SV=1 | 81 | 777 | 3.0E-52 |
sp|P63433|ACNA_STAAM | Aconitate hydratase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=acnA PE=3 SV=1 | 81 | 777 | 3.0E-52 |
sp|Q5HG69|ACNA_STAAC | Aconitate hydratase A OS=Staphylococcus aureus (strain COL) GN=acnA PE=3 SV=1 | 81 | 777 | 3.0E-52 |
sp|Q6GH55|ACNA_STAAR | Aconitate hydratase A OS=Staphylococcus aureus (strain MRSA252) GN=acnA PE=3 SV=1 | 81 | 777 | 4.0E-52 |
sp|Q23500|ACOC_CAEEL | Probable cytoplasmic aconitate hydratase OS=Caenorhabditis elegans GN=aco-1 PE=1 SV=1 | 86 | 737 | 2.0E-51 |
sp|Q54X73|ACOC_DICDI | Probable cytoplasmic aconitate hydratase OS=Dictyostelium discoideum GN=aco1 PE=3 SV=1 | 91 | 711 | 4.0E-51 |
sp|Q8FTA8|ACNA_COREF | Aconitate hydratase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=acn PE=3 SV=2 | 91 | 777 | 5.0E-51 |
sp|P21399|ACOC_HUMAN | Cytoplasmic aconitate hydratase OS=Homo sapiens GN=ACO1 PE=1 SV=3 | 93 | 780 | 6.0E-51 |
sp|Q5HPJ0|ACNA_STAEQ | Aconitate hydratase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=acnA PE=3 SV=1 | 93 | 777 | 8.0E-51 |
sp|Q8CPC2|ACNA_STAES | Aconitate hydratase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=acnA PE=3 SV=1 | 93 | 777 | 9.0E-51 |
sp|Q2A1K3|ACNA_FRATH | Aconitate hydratase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=acn PE=3 SV=1 | 95 | 713 | 2.0E-50 |
sp|Q8ZP52|ACNA_SALTY | Aconitate hydratase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acnA PE=1 SV=1 | 94 | 755 | 2.0E-49 |
sp|Q9WZ24|LEUC2_THEMA | 3-isopropylmalate dehydratase large subunit 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC2 PE=3 SV=1 | 65 | 492 | 1.0E-48 |
sp|P37032|ACON_LEGPH | Aconitate hydratase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=acn PE=1 SV=1 | 91 | 783 | 1.0E-48 |
sp|O27668|HACA_METTH | Probable methanogen homoaconitase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hacA PE=3 SV=1 | 129 | 508 | 3.0E-47 |
sp|P25516|ACNA_ECOLI | Aconitate hydratase A OS=Escherichia coli (strain K12) GN=acnA PE=1 SV=3 | 74 | 755 | 4.0E-47 |
sp|O28084|LEUC2_ARCFU | 3-isopropylmalate dehydratase large subunit 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC2 PE=3 SV=1 | 96 | 492 | 6.0E-47 |
sp|Q4JVM4|ACNA_CORJK | Aconitate hydratase A OS=Corynebacterium jeikeium (strain K411) GN=acn PE=3 SV=1 | 91 | 780 | 1.0E-46 |
sp|Q9RTN7|ACNA_DEIRA | Aconitate hydratase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acn PE=1 SV=1 | 91 | 774 | 2.0E-46 |
sp|B3VKQ2|IREB2_PIG | Iron-responsive element-binding protein 2 OS=Sus scrofa GN=IREB2 PE=2 SV=1 | 78 | 780 | 1.0E-45 |
sp|Q9WYC7|LEUC1_THEMA | 3-isopropylmalate dehydratase large subunit 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC1 PE=3 SV=1 | 66 | 508 | 1.0E-45 |
sp|Q2HZ33|LYS4_CANPA | Homoaconitase, mitochondrial OS=Candida parapsilosis GN=LYS4 PE=3 SV=1 | 61 | 723 | 2.0E-45 |
sp|Q6L0K5|LEUC_PICTO | 3-isopropylmalate dehydratase large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=leuC PE=3 SV=1 | 76 | 508 | 2.0E-45 |
sp|Q0VCU1|ACOC_BOVIN | Cytoplasmic aconitate hydratase OS=Bos taurus GN=ACO1 PE=2 SV=1 | 93 | 780 | 2.0E-45 |
sp|Q90875|ACOC_CHICK | Cytoplasmic aconitate hydratase OS=Gallus gallus GN=ACO1 PE=2 SV=1 | 93 | 783 | 3.0E-45 |
sp|Q9I3F5|ACNA_PSEAE | Aconitate hydratase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acnA PE=3 SV=1 | 91 | 777 | 4.0E-45 |
sp|B2KBD7|LEUC_ELUMP | 3-isopropylmalate dehydratase large subunit OS=Elusimicrobium minutum (strain Pei191) GN=leuC PE=3 SV=1 | 64 | 508 | 4.0E-45 |
sp|Q62751|IREB2_RAT | Iron-responsive element-binding protein 2 OS=Rattus norvegicus GN=Ireb2 PE=1 SV=2 | 78 | 780 | 7.0E-45 |
sp|P28271|ACOC_MOUSE | Cytoplasmic aconitate hydratase OS=Mus musculus GN=Aco1 PE=1 SV=3 | 93 | 780 | 3.0E-44 |
sp|Q97EE0|LEUC_CLOAB | 3-isopropylmalate dehydratase large subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuC PE=3 SV=1 | 61 | 481 | 3.0E-44 |
sp|Q58409|HACA_METJA | Methanogen homoaconitase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hacA PE=1 SV=1 | 144 | 508 | 6.0E-44 |
sp|Q01059|ACOC_RABIT | Cytoplasmic aconitate hydratase OS=Oryctolagus cuniculus GN=ACO1 PE=1 SV=1 | 93 | 731 | 7.0E-44 |
sp|P48200|IREB2_HUMAN | Iron-responsive element-binding protein 2 OS=Homo sapiens GN=IREB2 PE=1 SV=3 | 78 | 780 | 1.0E-43 |
sp|Q811J3|IREB2_MOUSE | Iron-responsive element-binding protein 2 OS=Mus musculus GN=Ireb2 PE=1 SV=2 | 78 | 780 | 2.0E-43 |
sp|O67078|LEUC_AQUAE | 3-isopropylmalate dehydratase large subunit OS=Aquifex aeolicus (strain VF5) GN=leuC PE=3 SV=1 | 65 | 520 | 3.0E-43 |
sp|Q63270|ACOC_RAT | Cytoplasmic aconitate hydratase OS=Rattus norvegicus GN=Aco1 PE=1 SV=1 | 93 | 731 | 4.0E-43 |
sp|B4U7U5|LEUC_HYDS0 | 3-isopropylmalate dehydratase large subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=leuC PE=3 SV=1 | 66 | 508 | 6.0E-43 |
sp|Q5ZLQ4|IREB2_CHICK | Iron-responsive element-binding protein 2 OS=Gallus gallus GN=IREB2 PE=2 SV=1 | 88 | 780 | 1.0E-42 |
sp|Q2RG98|LEUC_MOOTA | 3-isopropylmalate dehydratase large subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=leuC PE=3 SV=1 | 65 | 508 | 2.0E-42 |
sp|A4XJ48|LEUC_CALS8 | 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuC PE=3 SV=1 | 61 | 481 | 2.0E-42 |
sp|Q4WUL6|LYS4_ASPFU | Homoaconitase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lys4 PE=2 SV=1 | 64 | 508 | 3.0E-42 |
sp|O28316|LEUC1_ARCFU | 3-isopropylmalate dehydratase large subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC1 PE=3 SV=2 | 66 | 508 | 3.0E-42 |
sp|Q8U2A1|LEUC1_PYRFU | 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC1 PE=3 SV=1 | 65 | 508 | 4.0E-42 |
sp|Q74BX5|LEUC_GEOSL | 3-isopropylmalate dehydratase large subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuC PE=3 SV=1 | 66 | 508 | 3.0E-41 |
sp|Q8TVF2|LEUC1_METKA | 3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC1 PE=3 SV=1 | 66 | 481 | 4.0E-41 |
sp|P0CM03|LYS4_CRYNB | Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LYS4 PE=3 SV=1 | 64 | 481 | 4.0E-41 |
sp|B9MLV4|LEUC_CALBD | 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=leuC PE=3 SV=1 | 61 | 481 | 5.0E-41 |
sp|P0CM02|LYS4_CRYNJ | Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LYS4 PE=3 SV=1 | 64 | 481 | 5.0E-41 |
sp|Q6C791|LYS4_YARLI | Homoaconitase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS4 PE=3 SV=1 | 43 | 519 | 6.0E-41 |
sp|Q92412|LYS4_EMENI | Homoaconitase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lys4 PE=3 SV=2 | 64 | 508 | 7.0E-41 |
sp|Q58FL6|LYS4_ASPNC | Homoaconitase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lysA PE=3 SV=1 | 64 | 508 | 9.0E-41 |
sp|Q6BM98|LYS4_DEBHA | Homoaconitase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LYS4 PE=3 SV=1 | 61 | 742 | 1.0E-40 |
sp|B8J4F9|LEUC_DESDA | 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=leuC PE=3 SV=1 | 66 | 508 | 2.0E-40 |
sp|Q6CT61|LYS4_KLULA | Homoaconitase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LYS4 PE=3 SV=1 | 67 | 721 | 2.0E-40 |
sp|A5MZ75|LEUC_CLOK5 | 3-isopropylmalate dehydratase large subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuC PE=3 SV=1 | 65 | 481 | 3.0E-40 |
sp|Q9UZ07|LEUC1_PYRAB | 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC1 PE=3 SV=1 | 65 | 508 | 4.0E-40 |
sp|Q30WD3|LEUC_DESAG | 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio alaskensis (strain G20) GN=leuC PE=3 SV=1 | 66 | 481 | 1.0E-39 |
sp|Q2U9G3|LYS4_ASPOR | Homoaconitase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lys4 PE=3 SV=1 | 64 | 508 | 1.0E-39 |
sp|Q39W70|LEUC_GEOMG | 3-isopropylmalate dehydratase large subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuC PE=3 SV=1 | 66 | 508 | 1.0E-39 |
sp|Q8RDK2|LEUC_CALS4 | 3-isopropylmalate dehydratase large subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuC PE=3 SV=1 | 65 | 481 | 2.0E-39 |
sp|A5G7U4|LEUC_GEOUR | 3-isopropylmalate dehydratase large subunit OS=Geobacter uraniireducens (strain Rf4) GN=leuC PE=3 SV=1 | 65 | 508 | 2.0E-39 |
sp|Q24XT4|LEUC_DESHY | 3-isopropylmalate dehydratase large subunit OS=Desulfitobacterium hafniense (strain Y51) GN=leuC PE=3 SV=2 | 65 | 508 | 3.0E-39 |
sp|B8CX22|LEUC_HALOH | 3-isopropylmalate dehydratase large subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuC PE=3 SV=1 | 65 | 481 | 4.0E-39 |
sp|Q5A644|LYS4_CANAL | Homoaconitase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LYS4 PE=3 SV=1 | 60 | 713 | 5.0E-39 |
sp|B0TCR2|LEUC_HELMI | 3-isopropylmalate dehydratase large subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuC PE=3 SV=1 | 65 | 507 | 5.0E-39 |
sp|B2UYH6|LEUC_CLOBA | 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=leuC PE=3 SV=1 | 65 | 481 | 5.0E-39 |
sp|Q75DX9|LYS4_ASHGO | Homoaconitase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS4 PE=3 SV=2 | 68 | 481 | 6.0E-39 |
sp|A0JMA0|IREB2_XENTR | Iron-responsive element-binding protein 2 OS=Xenopus tropicalis GN=ireb2 PE=2 SV=1 | 137 | 780 | 2.0E-38 |
sp|A7IA28|LEUC_METB6 | 3-isopropylmalate dehydratase large subunit OS=Methanoregula boonei (strain 6A8) GN=leuC PE=3 SV=1 | 81 | 508 | 3.0E-38 |
sp|Q0QLE2|DMDA_EUBBA | 2,3-dimethylmalate dehydratase large subunit OS=Eubacterium barkeri GN=dmdA PE=1 SV=1 | 65 | 508 | 4.0E-38 |
sp|A9A043|LEUC_DESOH | 3-isopropylmalate dehydratase large subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=leuC PE=3 SV=1 | 66 | 489 | 7.0E-38 |
sp|B2TIQ9|LEUC_CLOBB | 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=leuC PE=3 SV=1 | 65 | 481 | 8.0E-38 |
sp|Q7M9Z9|LEUC_WOLSU | 3-isopropylmalate dehydratase large subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuC PE=3 SV=1 | 66 | 487 | 1.0E-37 |
sp|Q8EN69|LEUC_OCEIH | 3-isopropylmalate dehydratase large subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuC PE=3 SV=1 | 147 | 507 | 1.0E-37 |
sp|P18250|LEUC_PHYB8 | 3-isopropylmalate dehydratase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=leu1 PE=3 SV=2 | 173 | 740 | 4.0E-37 |
sp|B2V844|LEUC_SULSY | 3-isopropylmalate dehydratase large subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=leuC PE=3 SV=1 | 65 | 508 | 5.0E-37 |
sp|B0K0Y2|LEUC_THEPX | 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter sp. (strain X514) GN=leuC PE=3 SV=1 | 65 | 481 | 6.0E-37 |
sp|B5EHU2|LEUC_GEOBB | 3-isopropylmalate dehydratase large subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuC PE=3 SV=1 | 65 | 508 | 9.0E-37 |
sp|Q1AVC5|LEUC2_RUBXD | 3-isopropylmalate dehydratase large subunit 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC2 PE=3 SV=1 | 64 | 481 | 9.0E-37 |
sp|Q4HVQ9|LYS4_GIBZE | Homoaconitase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LYS4 PE=3 SV=1 | 61 | 508 | 1.0E-36 |
sp|B5YKE0|LEUC_THEYD | 3-isopropylmalate dehydratase large subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=leuC PE=3 SV=1 | 65 | 507 | 2.0E-36 |
sp|A3DHI4|LEUC_CLOTH | 3-isopropylmalate dehydratase large subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuC PE=3 SV=1 | 65 | 507 | 2.0E-36 |
sp|Q2LWJ2|LEUC_SYNAS | 3-isopropylmalate dehydratase large subunit OS=Syntrophus aciditrophicus (strain SB) GN=leuC PE=3 SV=1 | 65 | 508 | 2.0E-36 |
sp|Q6NTP2|IREB2_XENLA | Iron-responsive element-binding protein 2 OS=Xenopus laevis GN=ireb2 PE=2 SV=1 | 138 | 780 | 3.0E-36 |
sp|Q9RTI6|LEUC2_DEIRA | 3-isopropylmalate dehydratase large subunit 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC2 PE=3 SV=1 | 65 | 508 | 5.0E-36 |
sp|A6Q5L6|LEUC_NITSB | 3-isopropylmalate dehydratase large subunit OS=Nitratiruptor sp. (strain SB155-2) GN=leuC PE=3 SV=1 | 66 | 481 | 7.0E-36 |
sp|A7ZFP0|LEUC_CAMC1 | 3-isopropylmalate dehydratase large subunit OS=Campylobacter concisus (strain 13826) GN=leuC PE=3 SV=1 | 66 | 481 | 7.0E-36 |
sp|Q6FM51|LYS4_CANGA | Homoaconitase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS4 PE=3 SV=1 | 57 | 721 | 7.0E-36 |
sp|B0KAH5|LEUC_THEP3 | 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=leuC PE=3 SV=1 | 65 | 481 | 9.0E-36 |
sp|Q5V518|LEUC_HALMA | 3-isopropylmalate dehydratase large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=leuC PE=3 SV=1 | 164 | 508 | 9.0E-36 |
sp|P75764|YBHJ_ECOLI | Uncharacterized protein YbhJ OS=Escherichia coli (strain K12) GN=ybhJ PE=3 SV=2 | 91 | 776 | 1.0E-35 |
sp|Q8PZT3|HACA_METMA | Probable methanogen homoaconitase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hacA PE=3 SV=1 | 96 | 481 | 1.0E-35 |
sp|A6Q6J8|LEUC_SULNB | 3-isopropylmalate dehydratase large subunit OS=Sulfurovum sp. (strain NBC37-1) GN=leuC PE=3 SV=1 | 66 | 487 | 1.0E-35 |
sp|Q8TLF1|HACA_METAC | Probable methanogen homoaconitase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hacA PE=3 SV=1 | 96 | 481 | 1.0E-35 |
sp|Q47SA3|LEUC_THEFY | 3-isopropylmalate dehydratase large subunit OS=Thermobifida fusca (strain YX) GN=leuC PE=3 SV=1 | 173 | 508 | 1.0E-35 |
sp|B9L6Y8|LEUC_NAUPA | 3-isopropylmalate dehydratase large subunit OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=leuC PE=3 SV=1 | 64 | 481 | 2.0E-35 |
sp|A6LPX4|LEUC_CLOB8 | 3-isopropylmalate dehydratase large subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuC PE=3 SV=1 | 65 | 481 | 2.0E-35 |
sp|Q18AJ2|LEUC_PEPD6 | 3-isopropylmalate dehydratase large subunit OS=Peptoclostridium difficile (strain 630) GN=leuC PE=3 SV=1 | 65 | 481 | 2.0E-35 |
sp|Q870W1|LYS4_NEUCR | Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 | 64 | 508 | 2.0E-35 |
sp|B8DM92|LEUC_DESVM | 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuC PE=3 SV=1 | 66 | 481 | 3.0E-35 |
sp|P44968|LEUC_HAEIN | 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuC PE=3 SV=2 | 129 | 507 | 3.0E-35 |
sp|Q7ZAG7|LEUC_HALVD | 3-isopropylmalate dehydratase large subunit OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuC PE=3 SV=2 | 121 | 508 | 4.0E-35 |
sp|A7H0L8|LEUC_CAMC5 | 3-isopropylmalate dehydratase large subunit OS=Campylobacter curvus (strain 525.92) GN=leuC PE=3 SV=1 | 96 | 481 | 4.0E-35 |
sp|A1VAE7|LEUC_DESVV | 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuC PE=3 SV=1 | 66 | 508 | 7.0E-35 |
sp|Q2G958|LEUC_NOVAD | 3-isopropylmalate dehydratase large subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuC PE=3 SV=1 | 173 | 508 | 7.0E-35 |
sp|A8EQZ0|LEUC_ARCB4 | 3-isopropylmalate dehydratase large subunit OS=Arcobacter butzleri (strain RM4018) GN=leuC PE=3 SV=1 | 66 | 481 | 1.0E-34 |
sp|A5FKC6|LEUC_FLAJ1 | 3-isopropylmalate dehydratase large subunit OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=leuC PE=3 SV=1 | 96 | 508 | 1.0E-34 |
sp|Q4JC09|LEUC_SULAC | 3-isopropylmalate dehydratase large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuC PE=3 SV=1 | 64 | 508 | 1.0E-34 |
sp|Q03UM2|LEUC_LEUMM | 3-isopropylmalate dehydratase large subunit OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=leuC PE=3 SV=1 | 147 | 517 | 1.0E-34 |
sp|O27439|LEUC_METTH | Probable 3-isopropylmalate dehydratase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuC PE=3 SV=1 | 65 | 482 | 1.0E-34 |
sp|A0AK94|LEUC_LISW6 | 3-isopropylmalate dehydratase large subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuC PE=3 SV=1 | 150 | 489 | 1.0E-34 |
sp|Q7VH31|LEUC_HELHP | 3-isopropylmalate dehydratase large subunit OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuC PE=3 SV=1 | 173 | 508 | 2.0E-34 |
sp|P55251|LEUC_RHIPU | 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 | 173 | 729 | 2.0E-34 |
sp|P55811|LEUC_RHINI | 3-isopropylmalate dehydratase OS=Rhizopus niveus GN=LEU1 PE=3 SV=1 | 173 | 711 | 2.0E-34 |
sp|A4IRH6|LEUC_GEOTN | 3-isopropylmalate dehydratase large subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuC PE=3 SV=2 | 172 | 507 | 2.0E-34 |
sp|P56934|LEUC_BUCAI | 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuC PE=3 SV=2 | 170 | 507 | 2.0E-34 |
sp|Q4QLS2|LEUC_HAEI8 | 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain 86-028NP) GN=leuC PE=3 SV=1 | 129 | 507 | 2.0E-34 |
sp|P49367|LYS4_YEAST | Homoaconitase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS4 PE=1 SV=1 | 67 | 721 | 3.0E-34 |
sp|Q92A26|LEUC_LISIN | 3-isopropylmalate dehydratase large subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuC PE=3 SV=1 | 150 | 489 | 3.0E-34 |
sp|P81291|LEUC_METJA | Isopropylmalate/citramalate isomerase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuC PE=1 SV=1 | 141 | 507 | 3.0E-34 |
sp|A1SLW5|LEUC_NOCSJ | 3-isopropylmalate dehydratase large subunit OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuC PE=3 SV=1 | 149 | 520 | 3.0E-34 |
sp|B8DBU2|LEUC_LISMH | 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuC PE=3 SV=1 | 150 | 489 | 4.0E-34 |
sp|Q9UT74|LYS4_SCHPO | Homoaconitase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys2 PE=3 SV=1 | 62 | 507 | 4.0E-34 |
sp|Q65V07|LEUC2_MANSM | 3-isopropylmalate dehydratase large subunit 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC2 PE=3 SV=1 | 70 | 489 | 5.0E-34 |
sp|B9MDK8|LEUC_ACIET | 3-isopropylmalate dehydratase large subunit OS=Acidovorax ebreus (strain TPSY) GN=leuC PE=3 SV=1 | 167 | 489 | 6.0E-34 |
sp|Q4FP15|LEUC_PELUB | 3-isopropylmalate dehydratase large subunit OS=Pelagibacter ubique (strain HTCC1062) GN=leuC PE=3 SV=1 | 64 | 507 | 6.0E-34 |
sp|A1WAS7|LEUC_ACISJ | 3-isopropylmalate dehydratase large subunit OS=Acidovorax sp. (strain JS42) GN=leuC PE=3 SV=1 | 167 | 489 | 7.0E-34 |
sp|Q726X4|LEUC_DESVH | 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuC PE=3 SV=1 | 66 | 508 | 7.0E-34 |
sp|A5UD83|LEUC_HAEIE | 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain PittEE) GN=leuC PE=3 SV=1 | 129 | 507 | 7.0E-34 |
sp|Q5E858|LEUC_VIBF1 | 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuC PE=3 SV=1 | 70 | 489 | 7.0E-34 |
sp|Q30NZ0|LEUC_SULDN | 3-isopropylmalate dehydratase large subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuC PE=3 SV=1 | 66 | 481 | 8.0E-34 |
sp|Q4P521|LYS4_USTMA | Homoaconitase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LYS4 PE=3 SV=2 | 67 | 507 | 8.0E-34 |
sp|B5FGH2|LEUC_VIBFM | 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain MJ11) GN=leuC PE=3 SV=1 | 70 | 489 | 9.0E-34 |
sp|A1T700|LEUC_MYCVP | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuC PE=3 SV=1 | 161 | 508 | 9.0E-34 |
sp|A4FMP2|LEUC_SACEN | 3-isopropylmalate dehydratase large subunit OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuC PE=3 SV=1 | 141 | 508 | 1.0E-33 |
sp|A5UUP5|LEUC_ROSS1 | 3-isopropylmalate dehydratase large subunit OS=Roseiflexus sp. (strain RS-1) GN=leuC PE=3 SV=1 | 64 | 508 | 1.0E-33 |
sp|Q00464|LEUC_CANMA | 3-isopropylmalate dehydratase OS=Candida maltosa GN=LEU1 PE=3 SV=1 | 64 | 722 | 1.0E-33 |
sp|C5D5L8|LEUC_GEOSW | 3-isopropylmalate dehydratase large subunit OS=Geobacillus sp. (strain WCH70) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-33 |
sp|A9KT79|LEUC_CLOPH | 3-isopropylmalate dehydratase large subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=leuC PE=3 SV=1 | 173 | 481 | 2.0E-33 |
sp|B0USF4|LEUC_HISS2 | 3-isopropylmalate dehydratase large subunit OS=Histophilus somni (strain 2336) GN=leuC PE=3 SV=1 | 129 | 489 | 2.0E-33 |
sp|Q0I2G3|LEUC_HAES1 | 3-isopropylmalate dehydratase large subunit OS=Haemophilus somnus (strain 129Pt) GN=leuC PE=3 SV=1 | 129 | 489 | 2.0E-33 |
sp|Q8Y5R7|LEUC_LISMO | 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuC PE=3 SV=1 | 150 | 489 | 2.0E-33 |
sp|Q2GN26|LYS4_CHAGB | Homoaconitase, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LYS4 PE=3 SV=1 | 60 | 508 | 2.0E-33 |
sp|P07264|LEUC_YEAST | 3-isopropylmalate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU1 PE=1 SV=3 | 62 | 722 | 2.0E-33 |
sp|B1MVR0|LEUC_LEUCK | 3-isopropylmalate dehydratase large subunit OS=Leuconostoc citreum (strain KM20) GN=leuC PE=3 SV=1 | 147 | 507 | 2.0E-33 |
sp|B7GNM7|LEUC_BIFLS | 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuC PE=3 SV=1 | 173 | 508 | 2.0E-33 |
sp|C1F700|LEUC_ACIC5 | 3-isopropylmalate dehydratase large subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=leuC PE=3 SV=1 | 125 | 508 | 2.0E-33 |
sp|B8FMM4|LEUC_DESAA | 3-isopropylmalate dehydratase large subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuC PE=3 SV=1 | 65 | 481 | 2.0E-33 |
sp|Q64QP1|LEUC_BACFR | 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain YCH46) GN=leuC PE=3 SV=1 | 92 | 508 | 3.0E-33 |
sp|Q5LAB1|LEUC_BACFN | 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuC PE=3 SV=1 | 92 | 508 | 3.0E-33 |
sp|Q9ZNE0|HACA_THET2 | Homoaconitase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hacA PE=1 SV=1 | 162 | 508 | 3.0E-33 |
sp|B8F3W8|LEUC_HAEPS | 3-isopropylmalate dehydratase large subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=leuC PE=3 SV=1 | 156 | 507 | 4.0E-33 |
sp|Q5KWJ5|LEUC_GEOKA | 3-isopropylmalate dehydratase large subunit OS=Geobacillus kaustophilus (strain HTA426) GN=leuC PE=3 SV=1 | 173 | 507 | 4.0E-33 |
sp|A7HZP6|LEUC_CAMHC | 3-isopropylmalate dehydratase large subunit OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuC PE=3 SV=1 | 66 | 481 | 4.0E-33 |
sp|Q71Y33|LEUC_LISMF | 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuC PE=3 SV=1 | 150 | 489 | 5.0E-33 |
sp|C1KWT3|LEUC_LISMC | 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuC PE=3 SV=1 | 150 | 489 | 5.0E-33 |
sp|Q2IJC2|LEUC_ANADE | 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuC PE=3 SV=1 | 141 | 495 | 6.0E-33 |
sp|Q6NH63|ACNA_CORDI | Aconitate hydratase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=acn PE=3 SV=1 | 91 | 357 | 6.0E-33 |
sp|O86534|LEUC_STRCO | 3-isopropylmalate dehydratase large subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuC PE=3 SV=1 | 173 | 508 | 7.0E-33 |
sp|Q1H0L4|LEUC_METFK | 3-isopropylmalate dehydratase large subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuC PE=3 SV=1 | 67 | 489 | 7.0E-33 |
sp|Q6NHL0|LEUC_CORDI | 3-isopropylmalate dehydratase large subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuC PE=3 SV=1 | 173 | 508 | 8.0E-33 |
sp|Q6LV26|LEUC_PHOPR | 3-isopropylmalate dehydratase large subunit OS=Photobacterium profundum GN=leuC PE=3 SV=2 | 66 | 489 | 8.0E-33 |
sp|A1TLH6|LEUC_ACIAC | 3-isopropylmalate dehydratase large subunit OS=Acidovorax citrulli (strain AAC00-1) GN=leuC PE=3 SV=1 | 167 | 489 | 8.0E-33 |
sp|B5ENJ1|LEUC_ACIF5 | 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=leuC PE=3 SV=1 | 67 | 489 | 8.0E-33 |
sp|B7J5E0|LEUC_ACIF2 | 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=leuC PE=3 SV=1 | 67 | 489 | 8.0E-33 |
sp|O04916|ACOC_SOLTU | Aconitate hydratase, cytoplasmic (Fragment) OS=Solanum tuberosum PE=2 SV=1 | 268 | 720 | 8.0E-33 |
sp|Q89X98|LEUC1_BRADU | 3-isopropylmalate dehydratase large subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC1 PE=3 SV=2 | 146 | 489 | 8.0E-33 |
sp|Q6FEW0|LEUC_ACIAD | 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuC PE=3 SV=1 | 133 | 489 | 8.0E-33 |
sp|A6L1V8|LEUC_BACV8 | 3-isopropylmalate dehydratase large subunit OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=leuC PE=3 SV=1 | 66 | 495 | 9.0E-33 |
sp|B4UAN0|LEUC_ANASK | 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain K) GN=leuC PE=3 SV=1 | 141 | 495 | 1.0E-32 |
sp|B9JUD6|LEUC_AGRVS | 3-isopropylmalate dehydratase large subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuC PE=3 SV=1 | 61 | 489 | 1.0E-32 |
sp|A6VQL0|LEUC_ACTSZ | 3-isopropylmalate dehydratase large subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuC PE=3 SV=1 | 70 | 489 | 1.0E-32 |
sp|O14289|LEUC_SCHPO | 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 | 64 | 709 | 1.0E-32 |
sp|B9LUZ3|LEUC_HALLT | 3-isopropylmalate dehydratase large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=leuC PE=3 SV=1 | 164 | 508 | 1.0E-32 |
sp|C5CSH5|LEUC_VARPS | 3-isopropylmalate dehydratase large subunit OS=Variovorax paradoxus (strain S110) GN=leuC PE=3 SV=1 | 148 | 489 | 1.0E-32 |
sp|Q7MP79|LEUC_VIBVY | 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain YJ016) GN=leuC PE=3 SV=1 | 173 | 489 | 1.0E-32 |
sp|A3M1S8|LEUC_ACIBT | 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=leuC PE=3 SV=2 | 136 | 489 | 1.0E-32 |
sp|Q8FPR3|LEUC_COREF | 3-isopropylmalate dehydratase large subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuC PE=3 SV=1 | 173 | 508 | 1.0E-32 |
sp|Q4JUX2|LEUC_CORJK | 3-isopropylmalate dehydratase large subunit OS=Corynebacterium jeikeium (strain K411) GN=leuC PE=3 SV=1 | 63 | 508 | 2.0E-32 |
sp|Q8DED9|LEUC_VIBVU | 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain CMCP6) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-32 |
sp|Q2JPG2|LEUC_SYNJB | 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuC PE=3 SV=1 | 150 | 507 | 2.0E-32 |
sp|A7NJH2|LEUC_ROSCS | 3-isopropylmalate dehydratase large subunit OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuC PE=3 SV=1 | 139 | 505 | 2.0E-32 |
sp|B9JCN5|LEUC_AGRRK | 3-isopropylmalate dehydratase large subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-32 |
sp|Q5YRY0|LEUC_NOCFA | 3-isopropylmalate dehydratase large subunit OS=Nocardia farcinica (strain IFM 10152) GN=leuC PE=3 SV=1 | 161 | 508 | 2.0E-32 |
sp|Q65VS0|LEUC1_MANSM | 3-isopropylmalate dehydratase large subunit 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC1 PE=3 SV=1 | 170 | 507 | 3.0E-32 |
sp|A4TE23|LEUC_MYCGI | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuC PE=3 SV=1 | 173 | 508 | 3.0E-32 |
sp|Q974R0|LEUC_SULTO | 3-isopropylmalate dehydratase large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuC PE=3 SV=1 | 64 | 485 | 3.0E-32 |
sp|A8MDY8|LEUC_CALMQ | 3-isopropylmalate dehydratase large subunit OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=leuC PE=3 SV=1 | 167 | 508 | 4.0E-32 |
sp|Q3IRQ4|LEUC_NATPD | 3-isopropylmalate dehydratase large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=leuC PE=3 SV=1 | 173 | 508 | 4.0E-32 |
sp|B7I4E1|LEUC_ACIB5 | 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB0057) GN=leuC PE=3 SV=1 | 136 | 489 | 4.0E-32 |
sp|Q2S0M6|LEUC_SALRD | 3-isopropylmalate dehydratase large subunit OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuC PE=3 SV=1 | 129 | 508 | 4.0E-32 |
sp|B7H0T7|LEUC_ACIB3 | 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB307-0294) GN=leuC PE=3 SV=1 | 136 | 489 | 4.0E-32 |
sp|Q2K376|LEUC_RHIEC | 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuC PE=3 SV=1 | 61 | 507 | 4.0E-32 |
sp|B8J825|LEUC_ANAD2 | 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=leuC PE=3 SV=1 | 141 | 495 | 5.0E-32 |
sp|B3PR22|LEUC_RHIE6 | 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CIAT 652) GN=leuC PE=3 SV=1 | 61 | 489 | 6.0E-32 |
sp|Q8F4E6|LEUC_LEPIN | 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuC PE=3 SV=1 | 167 | 507 | 6.0E-32 |
sp|Q72RC4|LEUC_LEPIC | 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuC PE=3 SV=1 | 167 | 507 | 6.0E-32 |
sp|Q8A6L7|LEUC_BACTN | 3-isopropylmalate dehydratase large subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuC PE=3 SV=1 | 92 | 495 | 6.0E-32 |
sp|Q1AZC4|LEUC1_RUBXD | 3-isopropylmalate dehydratase large subunit 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC1 PE=3 SV=1 | 138 | 508 | 6.0E-32 |
sp|B1MDQ1|LEUC_MYCA9 | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=leuC PE=3 SV=1 | 173 | 508 | 7.0E-32 |
sp|Q0VPI0|LEUC_ALCBS | 3-isopropylmalate dehydratase large subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuC PE=3 SV=2 | 147 | 489 | 7.0E-32 |
sp|Q393X2|LEUC_BURL3 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuC PE=3 SV=1 | 173 | 489 | 8.0E-32 |
sp|Q67MJ2|LEUC_SYMTH | 3-isopropylmalate dehydratase large subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuC PE=3 SV=1 | 167 | 489 | 8.0E-32 |
sp|B7GH21|LEUC_ANOFW | 3-isopropylmalate dehydratase large subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuC PE=3 SV=1 | 170 | 489 | 8.0E-32 |
sp|A1W1X0|LEUC_CAMJJ | 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuC PE=3 SV=1 | 141 | 510 | 9.0E-32 |
sp|A7H665|LEUC_CAMJD | 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuC PE=3 SV=1 | 141 | 510 | 1.0E-31 |
sp|Q73B98|LEUC_BACC1 | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuC PE=3 SV=1 | 172 | 507 | 1.0E-31 |
sp|Q9K8F0|LEUC_BACHD | 3-isopropylmalate dehydratase large subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuC PE=3 SV=1 | 147 | 507 | 1.0E-31 |
sp|Q0A9B0|LEUC_ALKEH | 3-isopropylmalate dehydratase large subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuC PE=3 SV=1 | 67 | 489 | 1.0E-31 |
sp|B2HII1|LEUC_MYCMM | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuC PE=3 SV=1 | 161 | 508 | 1.0E-31 |
sp|Q87SS9|LEUC_VIBPA | 3-isopropylmalate dehydratase large subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuC PE=3 SV=1 | 70 | 489 | 1.0E-31 |
sp|B8HAC9|LEUC_ARTCA | 3-isopropylmalate dehydratase large subunit OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=leuC PE=3 SV=1 | 148 | 508 | 1.0E-31 |
sp|Q6AFK7|LEUC_LEIXX | 3-isopropylmalate dehydratase large subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuC PE=3 SV=1 | 64 | 508 | 1.0E-31 |
sp|B0BS44|LEUC_ACTPJ | 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuC PE=3 SV=1 | 129 | 489 | 1.0E-31 |
sp|B6ELJ8|LEUC_ALISL | 3-isopropylmalate dehydratase large subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=leuC PE=3 SV=1 | 70 | 489 | 1.0E-31 |
sp|B2I359|LEUC_ACIBC | 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ACICU) GN=leuC PE=3 SV=1 | 136 | 489 | 1.0E-31 |
sp|A5G0G6|LEUC_ACICJ | 3-isopropylmalate dehydratase large subunit OS=Acidiphilium cryptum (strain JF-5) GN=leuC PE=3 SV=1 | 66 | 508 | 1.0E-31 |
sp|Q3IJS4|LEUC_PSEHT | 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuC PE=3 SV=1 | 140 | 489 | 1.0E-31 |
sp|A1WY14|LEUC_HALHL | 3-isopropylmalate dehydratase large subunit OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuC PE=3 SV=1 | 165 | 489 | 1.0E-31 |
sp|Q0BAC8|LEUC_BURCM | 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuC PE=3 SV=1 | 173 | 489 | 1.0E-31 |
sp|B1Z1N0|LEUC_BURA4 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain MC40-6) GN=leuC PE=3 SV=1 | 173 | 489 | 1.0E-31 |
sp|Q82JR8|LEUC_STRAW | 3-isopropylmalate dehydratase large subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuC PE=3 SV=1 | 161 | 508 | 1.0E-31 |
sp|Q126M9|LEUC_POLSJ | 3-isopropylmalate dehydratase large subunit OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuC PE=3 SV=1 | 167 | 489 | 2.0E-31 |
sp|A1K4A1|LEUC_AZOSB | 3-isopropylmalate dehydratase large subunit OS=Azoarcus sp. (strain BH72) GN=leuC PE=3 SV=1 | 173 | 508 | 2.0E-31 |
sp|A7MWC3|LEUC_VIBCB | 3-isopropylmalate dehydratase large subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-31 |
sp|A1AW36|LEUC_RUTMC | 3-isopropylmalate dehydratase large subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuC PE=3 SV=2 | 173 | 489 | 2.0E-31 |
sp|Q97VY2|LEUC_SULSO | 3-isopropylmalate dehydratase large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuC PE=3 SV=1 | 66 | 508 | 2.0E-31 |
sp|Q74ZM9|LEUC_ASHGO | 3-isopropylmalate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU1 PE=3 SV=2 | 165 | 722 | 2.0E-31 |
sp|B1VZ03|LEUC_STRGG | 3-isopropylmalate dehydratase large subunit OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuC PE=3 SV=1 | 173 | 508 | 2.0E-31 |
sp|A0ZZS7|LEUC_BIFAA | 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=leuC PE=3 SV=1 | 186 | 489 | 2.0E-31 |
sp|A0JXX8|LEUC_ARTS2 | 3-isopropylmalate dehydratase large subunit OS=Arthrobacter sp. (strain FB24) GN=leuC PE=3 SV=1 | 173 | 508 | 3.0E-31 |
sp|Q8UBY9|LEUC_AGRFC | 3-isopropylmalate dehydratase large subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuC PE=3 SV=2 | 61 | 489 | 3.0E-31 |
sp|Q8NQ98|ACNA_CORGL | Aconitate hydratase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acn PE=1 SV=2 | 91 | 373 | 3.0E-31 |
sp|Q0RDK7|LEUC_FRAAA | 3-isopropylmalate dehydratase large subunit OS=Frankia alni (strain ACN14a) GN=leuC PE=3 SV=1 | 161 | 508 | 3.0E-31 |
sp|Q9EVH7|LEUC_BUCUH | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuC PE=3 SV=1 | 170 | 481 | 3.0E-31 |
sp|B3GZY1|LEUC_ACTP7 | 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuC PE=3 SV=1 | 129 | 489 | 3.0E-31 |
sp|O85072|LEUC_BUCDN | 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuC PE=3 SV=1 | 142 | 511 | 3.0E-31 |
sp|A0RMG7|LEUC_CAMFF | 3-isopropylmalate dehydratase large subunit OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuC PE=3 SV=1 | 66 | 481 | 4.0E-31 |
sp|A0AZ60|LEUC_BURCH | 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain HI2424) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-31 |
sp|B1K377|LEUC_BURCC | 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain MC0-3) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-31 |
sp|Q1BM55|LEUC_BURCA | 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain AU 1054) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-31 |
sp|A3MYL1|LEUC_ACTP2 | 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuC PE=3 SV=1 | 129 | 489 | 4.0E-31 |
sp|Q8G4W2|LEUC_BIFLO | 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain NCC 2705) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-31 |
sp|B3DPI2|LEUC_BIFLD | 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain DJO10A) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-31 |
sp|A1R7K0|LEUC_ARTAT | 3-isopropylmalate dehydratase large subunit OS=Arthrobacter aurescens (strain TC1) GN=leuC PE=3 SV=1 | 173 | 508 | 4.0E-31 |
sp|Q7NUB6|LEUC_CHRVO | 3-isopropylmalate dehydratase large subunit OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuC PE=3 SV=1 | 167 | 507 | 4.0E-31 |
sp|B1H0A6|LEUC_UNCTG | 3-isopropylmalate dehydratase large subunit OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=leuC PE=3 SV=1 | 66 | 508 | 5.0E-31 |
sp|A4YF03|LEUC_METS5 | 3-isopropylmalate dehydratase large subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuC PE=3 SV=1 | 173 | 508 | 6.0E-31 |
sp|A0RBL4|LEUC_BACAH | 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=leuC PE=3 SV=1 | 172 | 507 | 6.0E-31 |
sp|Q21IY3|LEUC_SACD2 | 3-isopropylmalate dehydratase large subunit OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuC PE=3 SV=1 | 173 | 489 | 7.0E-31 |
sp|B5ZTI5|LEUC_RHILW | 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuC PE=3 SV=1 | 61 | 489 | 8.0E-31 |
sp|B9IUZ2|LEUC_BACCQ | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain Q1) GN=leuC PE=3 SV=1 | 172 | 489 | 8.0E-31 |
sp|B7HKC6|LEUC_BACC7 | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH187) GN=leuC PE=3 SV=1 | 172 | 489 | 8.0E-31 |
sp|A4G4F5|LEUC_HERAR | 3-isopropylmalate dehydratase large subunit OS=Herminiimonas arsenicoxydans GN=leuC PE=3 SV=1 | 162 | 507 | 9.0E-31 |
sp|A4JMB6|LEUC_BURVG | 3-isopropylmalate dehydratase large subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuC PE=3 SV=1 | 173 | 489 | 9.0E-31 |
sp|Q1MAJ9|LEUC_RHIL3 | 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuC PE=3 SV=1 | 61 | 489 | 1.0E-30 |
sp|Q2T7H8|LEUC_BURTA | 3-isopropylmalate dehydratase large subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-30 |
sp|Q5WEN5|LEUC_BACSK | 3-isopropylmalate dehydratase large subunit OS=Bacillus clausii (strain KSM-K16) GN=leuC PE=3 SV=1 | 147 | 507 | 1.0E-30 |
sp|A0L8J4|LEUC_MAGMM | 3-isopropylmalate dehydratase large subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuC PE=3 SV=1 | 66 | 489 | 1.0E-30 |
sp|A0PPZ6|LEUC_MYCUA | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium ulcerans (strain Agy99) GN=leuC PE=3 SV=1 | 161 | 508 | 1.0E-30 |
sp|A6T015|LEUC_JANMA | 3-isopropylmalate dehydratase large subunit OS=Janthinobacterium sp. (strain Marseille) GN=leuC PE=3 SV=1 | 162 | 507 | 1.0E-30 |
sp|A8FP33|LEUC_CAMJ8 | 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuC PE=3 SV=1 | 141 | 510 | 1.0E-30 |
sp|Q9PLW1|LEUC_CAMJE | 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuC PE=3 SV=1 | 141 | 510 | 1.0E-30 |
sp|A0QJB7|LEUC_MYCA1 | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium avium (strain 104) GN=leuC PE=3 SV=1 | 161 | 508 | 1.0E-30 |
sp|Q5HS78|LEUC_CAMJR | 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni (strain RM1221) GN=leuC PE=3 SV=1 | 141 | 510 | 1.0E-30 |
sp|Q2SJD8|LEUC_HAHCH | 3-isopropylmalate dehydratase large subunit OS=Hahella chejuensis (strain KCTC 2396) GN=leuC PE=3 SV=1 | 173 | 489 | 1.0E-30 |
sp|Q2RV55|LEUC_RHORT | 3-isopropylmalate dehydratase large subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuC PE=3 SV=1 | 61 | 508 | 1.0E-30 |
sp|Q7VQJ8|LEUC_BLOFL | 3-isopropylmalate dehydratase large subunit OS=Blochmannia floridanus GN=leuC PE=3 SV=1 | 115 | 489 | 1.0E-30 |
sp|Q0HE67|LEUC_SHESM | 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-4) GN=leuC PE=3 SV=1 | 64 | 489 | 1.0E-30 |
sp|Q2J6W9|LEUC_FRASC | 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain CcI3) GN=leuC PE=3 SV=1 | 161 | 508 | 1.0E-30 |
sp|Q73VI7|LEUC_MYCPA | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuC PE=3 SV=1 | 161 | 508 | 1.0E-30 |
sp|A4SWW8|LEUC_POLSQ | 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuC PE=3 SV=1 | 173 | 489 | 1.0E-30 |
sp|B2JQE1|LEUC_BURP8 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuC PE=3 SV=1 | 173 | 489 | 1.0E-30 |
sp|P17279|LEUC_MUCCL | 3-isopropylmalate dehydratase OS=Mucor circinelloides f. lusitanicus GN=LEUA PE=3 SV=1 | 165 | 508 | 1.0E-30 |
sp|Q9EVI0|LEUC_BUCUO | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuC PE=3 SV=1 | 129 | 489 | 2.0E-30 |
sp|A6W7Q7|LEUC_KINRD | 3-isopropylmalate dehydratase large subunit OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuC PE=3 SV=1 | 66 | 508 | 2.0E-30 |
sp|C1DD59|LEUC_LARHH | 3-isopropylmalate dehydratase large subunit OS=Laribacter hongkongensis (strain HLHK9) GN=leuC PE=3 SV=1 | 136 | 489 | 2.0E-30 |
sp|Q9RTY9|LEUC1_DEIRA | 3-isopropylmalate dehydratase large subunit 1 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC1 PE=3 SV=1 | 118 | 509 | 2.0E-30 |
sp|Q5P1J8|LEUC_AROAE | 3-isopropylmalate dehydratase large subunit OS=Aromatoleum aromaticum (strain EbN1) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-30 |
sp|Q46YV7|LEUC_CUPPJ | 3-isopropylmalate dehydratase large subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-30 |
sp|C1EMB1|LEUC_BACC3 | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain 03BB102) GN=leuC PE=3 SV=1 | 172 | 507 | 2.0E-30 |
sp|A3PXR2|LEUC_MYCSJ | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain JLS) GN=leuC PE=3 SV=1 | 161 | 508 | 3.0E-30 |
sp|Q1BAQ4|LEUC_MYCSS | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain MCS) GN=leuC PE=3 SV=1 | 161 | 508 | 3.0E-30 |
sp|A1UEA8|LEUC_MYCSK | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain KMS) GN=leuC PE=3 SV=1 | 161 | 508 | 3.0E-30 |
sp|A0L1Q8|LEUC_SHESA | 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain ANA-3) GN=leuC PE=3 SV=1 | 64 | 489 | 3.0E-30 |
sp|A4Y2M2|LEUC_SHEPC | 3-isopropylmalate dehydratase large subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuC PE=3 SV=1 | 96 | 489 | 3.0E-30 |
sp|Q493R2|LEUC_BLOPB | 3-isopropylmalate dehydratase large subunit OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuC PE=3 SV=1 | 47 | 507 | 3.0E-30 |
sp|Q3SHL1|LEUC_THIDA | 3-isopropylmalate dehydratase large subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuC PE=3 SV=1 | 173 | 489 | 3.0E-30 |
sp|Q7N127|LEUC_PHOLL | 3-isopropylmalate dehydratase large subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuC PE=3 SV=1 | 129 | 489 | 3.0E-30 |
sp|Q0HZT2|LEUC_SHESR | 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-7) GN=leuC PE=3 SV=1 | 156 | 489 | 3.0E-30 |
sp|Q2JQU3|LEUC_SYNJA | 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuC PE=3 SV=1 | 150 | 507 | 3.0E-30 |
sp|P9WQF5|LEUC_MYCTU | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuC PE=1 SV=1 | 161 | 508 | 4.0E-30 |
sp|P9WQF4|LEUC_MYCTO | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuC PE=3 SV=1 | 161 | 508 | 4.0E-30 |
sp|A5U6Z9|LEUC_MYCTA | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuC PE=3 SV=1 | 161 | 508 | 4.0E-30 |
sp|Q11CQ6|LEUC_CHESB | 3-isopropylmalate dehydratase large subunit OS=Chelativorans sp. (strain BNC1) GN=leuC PE=3 SV=1 | 64 | 489 | 4.0E-30 |
sp|C1AGA3|LEUC_MYCBT | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuC PE=3 SV=1 | 161 | 508 | 4.0E-30 |
sp|A1KMY2|LEUC_MYCBP | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuC PE=3 SV=1 | 161 | 508 | 4.0E-30 |
sp|Q7TXH6|LEUC_MYCBO | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuC PE=1 SV=1 | 161 | 508 | 4.0E-30 |
sp|Q9AQC6|LEUC_BUCUL | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuC PE=3 SV=1 | 170 | 481 | 4.0E-30 |
sp|Q8XXX3|LEUC_RALSO | 3-isopropylmalate dehydratase large subunit OS=Ralstonia solanacearum (strain GMI1000) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-30 |
sp|Q8TQZ3|LEUC_METAC | Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuC PE=3 SV=1 | 173 | 508 | 4.0E-30 |
sp|A9VLG9|LEUC_BACWK | 3-isopropylmalate dehydratase large subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuC PE=3 SV=1 | 173 | 489 | 4.0E-30 |
sp|Q2VZV4|LEUC_MAGSA | 3-isopropylmalate dehydratase large subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuC PE=3 SV=1 | 138 | 508 | 4.0E-30 |
sp|Q47WG2|LEUC_COLP3 | 3-isopropylmalate dehydratase large subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuC PE=3 SV=1 | 156 | 507 | 4.0E-30 |
sp|B1XV55|LEUC_POLNS | 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuC PE=3 SV=1 | 173 | 489 | 5.0E-30 |
sp|B7JFY7|LEUC_BACC0 | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH820) GN=leuC PE=3 SV=1 | 172 | 507 | 5.0E-30 |
sp|Q81T66|LEUC_BACAN | 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis GN=leuC PE=3 SV=1 | 172 | 507 | 5.0E-30 |
sp|C3L9Q5|LEUC_BACAC | 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuC PE=3 SV=1 | 172 | 507 | 5.0E-30 |
sp|C3P4Z8|LEUC_BACAA | 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain A0248) GN=leuC PE=3 SV=1 | 172 | 507 | 5.0E-30 |
sp|Q63DX6|LEUC_BACCZ | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ZK / E33L) GN=leuC PE=3 SV=1 | 172 | 507 | 6.0E-30 |
sp|A7GMU3|LEUC_BACCN | 3-isopropylmalate dehydratase large subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuC PE=3 SV=1 | 173 | 489 | 6.0E-30 |
sp|A1VRR0|LEUC_POLNA | 3-isopropylmalate dehydratase large subunit OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuC PE=3 SV=1 | 167 | 489 | 6.0E-30 |
sp|O31293|LEUC_BUCTS | 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuC PE=3 SV=1 | 173 | 505 | 6.0E-30 |
sp|A9LZF7|LEUC_NEIM0 | 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C (strain 053442) GN=leuC PE=3 SV=1 | 138 | 508 | 7.0E-30 |
sp|B7IN95|LEUC_BACC2 | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain G9842) GN=leuC PE=3 SV=1 | 172 | 507 | 7.0E-30 |
sp|Q326G3|LEUC_SHIBS | 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-30 |
sp|A1KU80|LEUC_NEIMF | 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuC PE=3 SV=1 | 138 | 508 | 9.0E-30 |
sp|Q6HLF1|LEUC_BACHK | 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuC PE=3 SV=1 | 172 | 507 | 9.0E-30 |
sp|Q65GJ0|LEUC_BACLD | 3-isopropylmalate dehydratase large subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuC PE=3 SV=1 | 172 | 507 | 1.0E-29 |
sp|Q92L76|LEUC_RHIME | 3-isopropylmalate dehydratase large subunit OS=Rhizobium meliloti (strain 1021) GN=leuC PE=3 SV=1 | 61 | 491 | 1.0E-29 |
sp|Q9EVG8|LEUC_BUCUM | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuC PE=3 SV=2 | 170 | 489 | 1.0E-29 |
sp|C3M9V0|LEUC_RHISN | 3-isopropylmalate dehydratase large subunit OS=Rhizobium sp. (strain NGR234) GN=leuC PE=3 SV=1 | 61 | 489 | 1.0E-29 |
sp|Q63JK9|LEUC_BURPS | 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain K96243) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|A3NM77|LEUC_BURP6 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 668) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|Q3JKG6|LEUC_BURP1 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1710b) GN=leuC PE=3 SV=2 | 154 | 489 | 1.0E-29 |
sp|A3P7N9|LEUC_BURP0 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1106a) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|Q9JU82|LEUC_NEIMA | 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuC PE=3 SV=1 | 138 | 508 | 1.0E-29 |
sp|A1UZ32|LEUC_BURMS | 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain SAVP1) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|Q62AI6|LEUC_BURMA | 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain ATCC 23344) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|A2S127|LEUC_BURM9 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10229) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|A3MBT5|LEUC_BURM7 | 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10247) GN=leuC PE=3 SV=1 | 154 | 489 | 1.0E-29 |
sp|A8L567|LEUC_FRASN | 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain EAN1pec) GN=leuC PE=3 SV=1 | 170 | 508 | 1.0E-29 |
sp|A1U0Y0|LEUC_MARHV | 3-isopropylmalate dehydratase large subunit OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=leuC PE=3 SV=1 | 172 | 489 | 1.0E-29 |
sp|A0KGM7|LEUC_AERHH | 3-isopropylmalate dehydratase large subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuC PE=3 SV=1 | 47 | 508 | 1.0E-29 |
sp|A1REY2|LEUC_SHESW | 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain W3-18-1) GN=leuC PE=3 SV=1 | 156 | 489 | 1.0E-29 |
sp|Q8E9N4|LEUC_SHEON | 3-isopropylmalate dehydratase large subunit OS=Shewanella oneidensis (strain MR-1) GN=leuC PE=3 SV=1 | 170 | 489 | 2.0E-29 |
sp|Q1QAF2|LEUC_PSYCK | 3-isopropylmalate dehydratase large subunit OS=Psychrobacter cryohalolentis (strain K5) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-29 |
sp|B4F196|LEUC_PROMH | 3-isopropylmalate dehydratase large subunit OS=Proteus mirabilis (strain HI4320) GN=leuC PE=3 SV=1 | 129 | 489 | 2.0E-29 |
sp|Q8FYG9|LEUC_BRUSU | 3-isopropylmalate dehydratase large subunit OS=Brucella suis biovar 1 (strain 1330) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|B0CIF7|LEUC_BRUSI | 3-isopropylmalate dehydratase large subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|A5VSN3|LEUC_BRUO2 | 3-isopropylmalate dehydratase large subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|Q8YJC9|LEUC_BRUME | 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|C0RFF1|LEUC_BRUMB | 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|A9M8P2|LEUC_BRUC2 | 3-isopropylmalate dehydratase large subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|Q57AZ0|LEUC_BRUAB | 3-isopropylmalate dehydratase large subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|Q2YLP7|LEUC_BRUA2 | 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain 2308) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|B2S860|LEUC_BRUA1 | 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain S19) GN=leuC PE=3 SV=1 | 61 | 489 | 2.0E-29 |
sp|Q3Z5T8|LEUC_SHISS | 3-isopropylmalate dehydratase large subunit OS=Shigella sonnei (strain Ss046) GN=leuC PE=3 SV=1 | 129 | 508 | 2.0E-29 |
sp|B8DVN0|LEUC_BIFA0 | 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-29 |
sp|Q44427|LEUC_ACTTI | 3-isopropylmalate dehydratase large subunit OS=Actinoplanes teichomyceticus GN=leuC PE=3 SV=1 | 173 | 508 | 2.0E-29 |
sp|Q81G10|LEUC_BACCR | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuC PE=3 SV=1 | 172 | 489 | 2.0E-29 |
sp|Q8ZW41|LEUC_PYRAE | 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuC PE=3 SV=1 | 147 | 481 | 2.0E-29 |
sp|P58945|LEUC_BUCPS | 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuC PE=3 SV=1 | 170 | 495 | 2.0E-29 |
sp|Q7VDT0|LEUC_PROMA | 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuC PE=3 SV=1 | 125 | 508 | 3.0E-29 |
sp|Q8CNL1|LEUC_STAES | 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuC PE=3 SV=1 | 149 | 507 | 3.0E-29 |
sp|P58946|LEUC_CORGL | 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuC PE=2 SV=1 | 173 | 508 | 3.0E-29 |
sp|A4X4C8|LEUC_SALTO | 3-isopropylmalate dehydratase large subunit OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=leuC PE=3 SV=1 | 148 | 508 | 3.0E-29 |
sp|A7Z7B6|LEUC_BACMF | 3-isopropylmalate dehydratase large subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuC PE=3 SV=1 | 173 | 507 | 3.0E-29 |
sp|Q9EVH4|LEUC_BUCUE | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuC PE=3 SV=1 | 170 | 489 | 4.0E-29 |
sp|Q4WBR0|ACON3_ASPFU | Putative aconitate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoC PE=2 SV=1 | 129 | 728 | 4.0E-29 |
sp|Q9JZI5|LEUC_NEIMB | 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuC PE=3 SV=1 | 138 | 508 | 4.0E-29 |
sp|A4QDS8|LEUC_CORGB | 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain R) GN=leuC PE=3 SV=1 | 173 | 508 | 4.0E-29 |
sp|Q938C9|LEUC_MYCS2 | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=leuC PE=3 SV=1 | 163 | 508 | 4.0E-29 |
sp|A6WXG4|LEUC_OCHA4 | 3-isopropylmalate dehydratase large subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuC PE=3 SV=1 | 61 | 489 | 4.0E-29 |
sp|Q8PUG1|LEUC_METMA | Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuC PE=3 SV=2 | 173 | 508 | 5.0E-29 |
sp|Q821C2|LEUC_SHIFL | 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri GN=leuC PE=3 SV=1 | 129 | 508 | 5.0E-29 |
sp|Q11NN8|LEUC_CYTH3 | 3-isopropylmalate dehydratase large subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=leuC PE=3 SV=1 | 139 | 507 | 5.0E-29 |
sp|Q3M614|LEUC_ANAVT | 3-isopropylmalate dehydratase large subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuC PE=3 SV=1 | 150 | 508 | 5.0E-29 |
sp|Q9EVI6|LEUC_BUCUN | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuC PE=3 SV=1 | 170 | 489 | 5.0E-29 |
sp|B7UIC2|LEUC_ECO27 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuC PE=3 SV=1 | 129 | 508 | 5.0E-29 |
sp|B4RM67|LEUC_NEIG2 | 3-isopropylmalate dehydratase large subunit OS=Neisseria gonorrhoeae (strain NCCP11945) GN=leuC PE=3 SV=1 | 167 | 508 | 6.0E-29 |
sp|B7L4J3|LEUC_ECO55 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain 55989 / EAEC) GN=leuC PE=3 SV=1 | 129 | 508 | 6.0E-29 |
sp|B1IRA6|LEUC_ECOLC | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuC PE=3 SV=1 | 129 | 508 | 6.0E-29 |
sp|A7ZW23|LEUC_ECOHS | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O9:H4 (strain HS) GN=leuC PE=3 SV=1 | 129 | 508 | 6.0E-29 |
sp|B2U279|LEUC_SHIB3 | 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|Q1RGC5|LEUC_ECOUT | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|B1LG09|LEUC_ECOSM | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|B6HZ52|LEUC_ECOSE | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SE11) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|P0A6A6|LEUC_ECOLI | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12) GN=leuC PE=1 SV=2 | 129 | 508 | 7.0E-29 |
sp|P0A6A7|LEUC_ECOL6 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuC PE=3 SV=2 | 129 | 508 | 7.0E-29 |
sp|Q0TLR7|LEUC_ECOL5 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|A1A7C0|LEUC_ECOK1 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O1:K1 / APEC GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|C4ZPZ5|LEUC_ECOBW | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|B7M117|LEUC_ECO8A | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O8 (strain IAI1) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|B7MNT0|LEUC_ECO81 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O81 (strain ED1a) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|B7NHI0|LEUC_ECO7I | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|B7MAJ7|LEUC_ECO45 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|Q01Z81|LEUC_SOLUE | 3-isopropylmalate dehydratase large subunit OS=Solibacter usitatus (strain Ellin6076) GN=leuC PE=3 SV=1 | 165 | 508 | 7.0E-29 |
sp|Q6D0G6|LEUC_PECAS | 3-isopropylmalate dehydratase large subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|A7ZHG4|LEUC_ECO24 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuC PE=3 SV=1 | 129 | 489 | 7.0E-29 |
sp|A8G2R6|LEUC_PROM2 | 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=leuC PE=3 SV=1 | 150 | 508 | 7.0E-29 |
sp|A7HT10|LEUC_PARL1 | 3-isopropylmalate dehydratase large subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuC PE=3 SV=1 | 173 | 508 | 7.0E-29 |
sp|B0KF81|LEUC_PSEPG | 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain GB-1) GN=leuC PE=3 SV=1 | 122 | 489 | 7.0E-29 |
sp|B7N7U7|LEUC_ECOLU | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuC PE=3 SV=1 | 129 | 508 | 7.0E-29 |
sp|Q0AT09|LEUC_MARMM | 3-isopropylmalate dehydratase large subunit OS=Maricaulis maris (strain MCS10) GN=leuC PE=3 SV=1 | 154 | 482 | 8.0E-29 |
sp|B7HHF7|LEUC_BACC4 | 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain B4264) GN=leuC PE=3 SV=1 | 172 | 507 | 8.0E-29 |
sp|B7LWE0|LEUC_ESCF3 | 3-isopropylmalate dehydratase large subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuC PE=3 SV=1 | 129 | 508 | 8.0E-29 |
sp|A9KY15|LEUC_SHEB9 | 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS195) GN=leuC PE=3 SV=1 | 96 | 489 | 9.0E-29 |
sp|A6WIB7|LEUC_SHEB8 | 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS185) GN=leuC PE=3 SV=1 | 96 | 489 | 9.0E-29 |
sp|A6UE05|LEUC_SINMW | 3-isopropylmalate dehydratase large subunit OS=Sinorhizobium medicae (strain WSM419) GN=leuC PE=3 SV=1 | 61 | 491 | 9.0E-29 |
sp|Q0T8C6|LEUC_SHIF8 | 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=leuC PE=3 SV=1 | 129 | 508 | 1.0E-28 |
sp|B7KH96|LEUC_CYAP7 | 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7424) GN=leuC PE=3 SV=1 | 140 | 508 | 1.0E-28 |
sp|A3CZK7|LEUC_SHEB5 | 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuC PE=3 SV=1 | 156 | 489 | 1.0E-28 |
sp|C6DEW0|LEUC_PECCP | 3-isopropylmalate dehydratase large subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuC PE=3 SV=1 | 129 | 508 | 1.0E-28 |
sp|Q1ICW0|LEUC_PSEE4 | 3-isopropylmalate dehydratase large subunit OS=Pseudomonas entomophila (strain L48) GN=leuC PE=3 SV=1 | 122 | 489 | 1.0E-28 |
sp|Q32K22|LEUC_SHIDS | 3-isopropylmalate dehydratase large subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuC PE=3 SV=1 | 129 | 508 | 1.0E-28 |
sp|B3PFN2|LEUC_CELJU | 3-isopropylmalate dehydratase large subunit OS=Cellvibrio japonicus (strain Ueda107) GN=leuC PE=3 SV=1 | 173 | 510 | 1.0E-28 |
sp|Q5F8T1|LEUC_NEIG1 | 3-isopropylmalate dehydratase large subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuC PE=3 SV=1 | 167 | 508 | 1.0E-28 |
sp|P49601|LEUC_USTMA | 3-isopropylmalate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEU1 PE=3 SV=1 | 163 | 508 | 2.0E-28 |
sp|A5WGT5|LEUC_PSYWF | 3-isopropylmalate dehydratase large subunit OS=Psychrobacter sp. (strain PRwf-1) GN=leuC PE=3 SV=1 | 173 | 489 | 2.0E-28 |
sp|A7MIC7|LEUC_CROS8 | 3-isopropylmalate dehydratase large subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuC PE=3 SV=1 | 129 | 508 | 2.0E-28 |
sp|Q8YX02|LEUC_NOSS1 | 3-isopropylmalate dehydratase large subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuC PE=3 SV=1 | 150 | 508 | 2.0E-28 |
sp|O33123|LEUC_MYCLE | 3-isopropylmalate dehydratase large subunit OS=Mycobacterium leprae (strain TN) GN=leuC PE=3 SV=1 | 173 | 508 | 2.0E-28 |
sp|B8E4K6|LEUC_SHEB2 | 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS223) GN=leuC PE=3 SV=1 | 96 | 489 | 2.0E-28 |
sp|B1LXK9|LEUC_METRJ | 3-isopropylmalate dehydratase large subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=leuC PE=3 SV=1 | 68 | 507 | 2.0E-28 |
sp|B1YD98|LEUC_PYRNV | 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuC PE=3 SV=1 | 91 | 481 | 2.0E-28 |
sp|A7HBI2|LEUC_ANADF | 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=leuC PE=3 SV=1 | 147 | 482 | 2.0E-28 |
sp|B1HR96|LEUC_LYSSC | 3-isopropylmalate dehydratase large subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=leuC PE=3 SV=1 | 156 | 495 | 2.0E-28 |
sp|A8M5I3|LEUC_SALAI | 3-isopropylmalate dehydratase large subunit OS=Salinispora arenicola (strain CNS-205) GN=leuC PE=3 SV=1 | 148 | 508 | 2.0E-28 |
sp|Q0BRH4|LEUC_GRABC | 3-isopropylmalate dehydratase large subunit OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuC PE=3 SV=1 | 173 | 508 | 3.0E-28 |
sp|B1JKA0|LEUC_YERPY | 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|A4TQA4|LEUC_YERPP | 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis (strain Pestoides F) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|Q1CMP7|LEUC_YERPN | 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|A9R144|LEUC_YERPG | 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|Q8ZIH0|LEUC_YERPE | 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|Q1C1Z4|LEUC_YERPA | 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|A7FM86|LEUC_YERP3 | 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|Q66EM3|LEUC_YERPS | 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|B2K4C7|LEUC_YERPB | 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|A1JJH5|LEUC_YERE8 | 3-isopropylmalate dehydratase large subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuC PE=3 SV=1 | 129 | 508 | 3.0E-28 |
sp|Q4L7U2|LEUC_STAHJ | 3-isopropylmalate dehydratase large subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuC PE=3 SV=1 | 149 | 507 | 3.0E-28 |
sp|Q5HMF7|LEUC_STAEQ | 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuC PE=3 SV=1 | 149 | 507 | 3.0E-28 |
sp|A3QIN8|LEUC_SHELP | 3-isopropylmalate dehydratase large subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuC PE=3 SV=1 | 156 | 489 | 3.0E-28 |
sp|Q89X34|LEUC2_BRADU | 3-isopropylmalate dehydratase large subunit 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC2 PE=3 SV=1 | 61 | 489 | 4.0E-28 |
sp|B5YZA8|LEUC_ECO5E | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuC PE=3 SV=1 | 129 | 489 | 4.0E-28 |
sp|Q8XA00|LEUC_ECO57 | 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 GN=leuC PE=3 SV=3 | 129 | 489 | 4.0E-28 |
sp|Q9EVI3|LEUC_BUCUS | 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuC PE=3 SV=1 | 170 | 481 | 4.0E-28 |
sp|Q5NRC5|LEUC_ZYMMO | 3-isopropylmalate dehydratase large subunit OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuC PE=3 SV=1 | 62 | 508 | 4.0E-28 |
sp|A6T4L7|LEUC_KLEP7 | 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuC PE=3 SV=1 | 129 | 489 | 4.0E-28 |
sp|A0LVA3|LEUC_ACIC1 | 3-isopropylmalate dehydratase large subunit OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuC PE=3 SV=1 | 161 | 508 | 5.0E-28 |
sp|B7K213|LEUC_CYAP8 | 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 8801) GN=leuC PE=3 SV=1 | 150 | 508 | 5.0E-28 |
sp|A8FFW3|LEUC_BACP2 | 3-isopropylmalate dehydratase large subunit OS=Bacillus pumilus (strain SAFR-032) GN=leuC PE=3 SV=1 | 172 | 507 | 5.0E-28 |
sp|Q88LE8|LEUC_PSEPK | 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain KT2440) GN=leuC PE=3 SV=1 | 122 | 489 | 5.0E-28 |
sp|C3LR34|LEUC_VIBCM | 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=leuC PE=3 SV=1 | 173 | 489 | 6.0E-28 |
sp|Q9KP81|LEUC_VIBCH | 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuC PE=3 SV=1 | 173 | 489 | 6.0E-28 |
sp|A5F5E2|LEUC_VIBC3 | 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=leuC PE=3 SV=1 | 173 | 489 | 6.0E-28 |
sp|Q31HI2|LEUC_THICR | 3-isopropylmalate dehydratase large subunit OS=Thiomicrospira crunogena (strain XCL-2) GN=leuC PE=3 SV=1 | 162 | 507 | 6.0E-28 |
sp|Q98EF1|LEUC_RHILO | 3-isopropylmalate dehydratase large subunit OS=Rhizobium loti (strain MAFF303099) GN=leuC PE=3 SV=1 | 61 | 489 | 7.0E-28 |
sp|Q4FRU7|LEUC_PSYA2 | 3-isopropylmalate dehydratase large subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuC PE=3 SV=1 | 173 | 489 | 7.0E-28 |
sp|A4WMI6|LEUC_PYRAR | 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuC PE=3 SV=1 | 147 | 481 | 7.0E-28 |
sp|Q82WI9|LEUC_NITEU | 3-isopropylmalate dehydratase large subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuC PE=3 SV=1 | 68 | 489 | 7.0E-28 |
sp|A2C088|LEUC_PROM1 | 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL1A) GN=leuC PE=3 SV=1 | 150 | 508 | 8.0E-28 |
sp|Q02142|LEUC_LACLA | 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuC PE=3 SV=2 | 67 | 507 | 8.0E-28 |
sp|A3MWJ4|LEUC_PYRCJ | 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuC PE=3 SV=1 | 167 | 508 | 8.0E-28 |
sp|B5Y1W4|LEUC_KLEP3 | 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae (strain 342) GN=leuC PE=3 SV=1 | 129 | 489 | 8.0E-28 |
sp|B1WZV3|LEUC_CYAA5 | 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain ATCC 51142) GN=leuC PE=3 SV=1 | 150 | 508 | 8.0E-28 |
sp|Q7VY75|LEUC_BORPE | 3-isopropylmalate dehydratase large subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuC PE=3 SV=1 | 154 | 489 | 8.0E-28 |
sp|Q7W931|LEUC_BORPA | 3-isopropylmalate dehydratase large subunit OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuC PE=3 SV=2 | 154 | 489 | 9.0E-28 |
sp|Q7WKH6|LEUC_BORBR | 3-isopropylmalate dehydratase large subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuC PE=3 SV=2 | 154 | 489 | 9.0E-28 |
sp|B7KRK4|LEUC_METC4 | 3-isopropylmalate dehydratase large subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=leuC PE=3 SV=1 | 70 | 507 | 9.0E-28 |
sp|A2BUN7|LEUC_PROM5 | 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9515) GN=leuC PE=3 SV=1 | 150 | 508 | 9.0E-28 |
sp|A6V2V3|LEUC_PSEA7 | 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain PA7) GN=leuC PE=3 SV=1 | 173 | 507 | 9.0E-28 |
sp|Q5FUG3|LEUC_GLUOX | 3-isopropylmalate dehydratase large subunit OS=Gluconobacter oxydans (strain 621H) GN=leuC PE=3 SV=1 | 156 | 507 | 1.0E-27 |
sp|Q8NQ98|ACNA_CORGL | Aconitate hydratase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acn PE=1 SV=2 | 379 | 782 | 8.0E-18 |
sp|Q6NH63|ACNA_CORDI | Aconitate hydratase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=acn PE=3 SV=1 | 379 | 777 | 3.0E-13 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 26 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 229.99 | 104.23 | 355.76 |
Initials | Initials knots | 138.26 | 78.05 | 198.47 |
Pileal_Stipeal_center | Stage I stipe center | 293.33 | 148.77 | 437.89 |
Pileal_Stipeal_shell | Stage I stipe shell | 289.27 | 146.03 | 432.51 |
DIF_stipe_center | Stage II stipe center | 265.80 | 137.46 | 394.13 |
DIF_stipe_shell | Stage II stipe shell | 257.19 | 133.67 | 380.71 |
DIF_stipe_skin | Stage II stipe skin | 246.93 | 129.29 | 364.58 |
DIF_cap_skin | Stage II cap skin | 381.04 | 180.65 | 581.44 |
DIF_cap_tissue | Stage II cap tissue | 364.93 | 176.66 | 553.19 |
DIF_gill_tissue | Stage II gill tissue | 301.11 | 150.95 | 451.28 |
YFB_stipe_center | Young fruiting body stipe center | 228.20 | 120.97 | 335.42 |
YFB_stipe_shell | Young fruiting body stipe shell | 231.82 | 122.75 | 340.88 |
YFB_stipe_skin | Young fruiting body stipe skin | 231.05 | 119.47 | 342.63 |
YFB_cap_skin | Young fruiting body cap skin | 371.00 | 177.48 | 564.53 |
YFB_cap_tissue | Young fruiting body cap tissue | 363.79 | 175.82 | 551.76 |
YFB_gill_tissue | Young fruiting body gill tissue | 297.49 | 149.80 | 445.18 |
YFB_veil | Young fruiting body veil | 287.23 | 141.71 | 432.74 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.569940 | no |
Casing | YFB_stipe_center | 0.989789 | no |
Casing | YFB_stipe_shell | 0.989577 | no |
Casing | YFB_stipe_skin | 0.994044 | no |
Casing | YFB_cap_skin | 0.240614 | no |
Casing | YFB_cap_tissue | 0.247911 | no |
Casing | YFB_gill_tissue | 0.592819 | no |
Casing | YFB_veil | 0.674728 | no |
Casing | Initials | 0.154525 | no |
Casing | Pileal_Stipeal_center | 0.621523 | no |
Casing | Pileal_Stipeal_shell | 0.645694 | no |
Casing | DIF_stipe_center | 0.794991 | no |
Casing | DIF_stipe_shell | 0.853897 | no |
Casing | DIF_stipe_skin | 0.913901 | no |
Casing | DIF_cap_skin | 0.205647 | no |
Casing | DIF_cap_tissue | 0.246828 | no |
DIF_gill_tissue | YFB_stipe_center | 0.500733 | no |
DIF_gill_tissue | YFB_stipe_shell | 0.528521 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.531678 | no |
DIF_gill_tissue | YFB_cap_skin | 0.674728 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.704100 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.985262 | no |
DIF_gill_tissue | YFB_veil | 0.943487 | no |
YFB_stipe_center | YFB_stipe_shell | 0.980154 | no |
YFB_stipe_center | YFB_stipe_skin | 0.984649 | no |
YFB_stipe_center | YFB_cap_skin | 0.180446 | no |
YFB_stipe_center | YFB_cap_tissue | 0.178449 | no |
YFB_stipe_center | YFB_gill_tissue | 0.525365 | no |
YFB_stipe_center | YFB_veil | 0.614972 | no |
YFB_stipe_shell | YFB_stipe_skin | 0.995307 | no |
YFB_stipe_shell | YFB_cap_skin | 0.193760 | no |
YFB_stipe_shell | YFB_cap_tissue | 0.195445 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.554517 | no |
YFB_stipe_shell | YFB_veil | 0.646169 | no |
YFB_stipe_skin | YFB_cap_skin | 0.194492 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.196877 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.558645 | no |
YFB_stipe_skin | YFB_veil | 0.645394 | no |
YFB_cap_skin | YFB_cap_tissue | 0.976932 | no |
YFB_cap_skin | YFB_gill_tissue | 0.656939 | no |
YFB_cap_skin | YFB_veil | 0.602045 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.679551 | no |
YFB_cap_tissue | YFB_veil | 0.621228 | no |
YFB_gill_tissue | YFB_veil | 0.958575 | no |
Initials | DIF_gill_tissue | 0.011968 | yes |
Initials | YFB_stipe_center | 0.105537 | no |
Initials | YFB_stipe_shell | 0.086585 | no |
Initials | YFB_stipe_skin | 0.100249 | no |
Initials | YFB_cap_skin | 0.002525 | yes |
Initials | YFB_cap_tissue | 0.000613 | yes |
Initials | YFB_gill_tissue | 0.014081 | yes |
Initials | YFB_veil | 0.023933 | yes |
Initials | Pileal_Stipeal_center | 0.013485 | yes |
Initials | Pileal_Stipeal_shell | 0.016104 | yes |
Initials | DIF_stipe_center | 0.030134 | yes |
Initials | DIF_stipe_shell | 0.040279 | yes |
Initials | DIF_stipe_skin | 0.059906 | no |
Initials | DIF_cap_skin | 0.000613 | yes |
Initials | DIF_cap_tissue | 0.002084 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.968292 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.559544 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.588380 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.590075 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.622063 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.649821 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 0.982867 | no |
Pileal_Stipeal_center | YFB_veil | 0.975035 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.983784 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.862364 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.807243 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.730088 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.571374 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.645394 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.949735 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.590826 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.622375 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.621228 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.596139 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.624900 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.965142 | no |
Pileal_Stipeal_shell | YFB_veil | 0.991415 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.882981 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.831965 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.757854 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.544115 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.620649 | no |
DIF_stipe_center | DIF_gill_tissue | 0.822018 | no |
DIF_stipe_center | YFB_stipe_center | 0.763722 | no |
DIF_stipe_center | YFB_stipe_shell | 0.791842 | no |
DIF_stipe_center | YFB_stipe_skin | 0.790175 | no |
DIF_stipe_center | YFB_cap_skin | 0.420849 | no |
DIF_stipe_center | YFB_cap_tissue | 0.436142 | no |
DIF_stipe_center | YFB_gill_tissue | 0.845369 | no |
DIF_stipe_center | YFB_veil | 0.903255 | no |
DIF_stipe_center | DIF_stipe_shell | 0.959355 | no |
DIF_stipe_center | DIF_stipe_skin | 0.903942 | no |
DIF_stipe_center | DIF_cap_skin | 0.370496 | no |
DIF_stipe_center | DIF_cap_tissue | 0.435715 | no |
DIF_stipe_shell | DIF_gill_tissue | 0.755749 | no |
DIF_stipe_shell | YFB_stipe_center | 0.823610 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.850267 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.849601 | no |
DIF_stipe_shell | YFB_cap_skin | 0.357977 | no |
DIF_stipe_shell | YFB_cap_tissue | 0.375522 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.781730 | no |
DIF_stipe_shell | YFB_veil | 0.850792 | no |
DIF_stipe_shell | DIF_stipe_skin | 0.949062 | no |
DIF_stipe_shell | DIF_cap_skin | 0.312871 | no |
DIF_stipe_shell | DIF_cap_tissue | 0.369867 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.677830 | no |
DIF_stipe_skin | YFB_stipe_center | 0.893058 | no |
DIF_stipe_skin | YFB_stipe_shell | 0.916935 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.914103 | no |
DIF_stipe_skin | YFB_cap_skin | 0.293079 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.308255 | no |
DIF_stipe_skin | YFB_gill_tissue | 0.704058 | no |
DIF_stipe_skin | YFB_veil | 0.780337 | no |
DIF_stipe_skin | DIF_cap_skin | 0.255267 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.302979 | no |
DIF_cap_skin | DIF_gill_tissue | 0.621767 | no |
DIF_cap_skin | YFB_stipe_center | 0.147547 | no |
DIF_cap_skin | YFB_stipe_shell | 0.158500 | no |
DIF_cap_skin | YFB_stipe_skin | 0.164623 | no |
DIF_cap_skin | YFB_cap_skin | 0.970787 | no |
DIF_cap_skin | YFB_cap_tissue | 0.946065 | no |
DIF_cap_skin | YFB_gill_tissue | 0.597420 | no |
DIF_cap_skin | YFB_veil | 0.545643 | no |
DIF_cap_skin | DIF_cap_tissue | 0.949840 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.697653 | no |
DIF_cap_tissue | YFB_stipe_center | 0.177697 | no |
DIF_cap_tissue | YFB_stipe_shell | 0.194610 | no |
DIF_cap_tissue | YFB_stipe_skin | 0.194969 | no |
DIF_cap_tissue | YFB_cap_skin | 0.981071 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.995947 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.674418 | no |
DIF_cap_tissue | YFB_veil | 0.619845 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|031470 MYNLAHKSAHAARAAKRMAAGMATAAPRIGDTKVAMSAFEKDAFINYQRIEDNLAVVRNRLKRPLTLSEKVVYGH LDDPHGQDINRGVSYLKLRPDRVACQDATAQMALLQFMSAGMDTAAVPTTVHCDHLIEAQIGGVKDLQRAIQTNK EVYDFLATATAKYGLGFWKPGSGIIHQILLENYAFPGGMMIGTDSHTPNAGGLGMVACGVGGADAVDVMAGIPWE LKCPKVIGVNLTGKIGGWTTPKDVILKVAGILTVKGGTGAIVEYKGPGVESLSCTGMATICNMGAEIGATTSLFP FNRRMVDYLQATKRSDIANYAKAFAHNLQADEAAEYDEHIEINLSELEPHINGPFTPDLATPISKFASEAKKNGW PEEVKVGLIGSCTNSSYEDMTRSASIVKQAADRGIDFKSKFTVTPGSEQVRATIARDGLIDSFEGAGAIVLANAC GPCIGQWDRQDVKKGEVNSIVTSYNRNFTGRNDANPATHAFVASPDITTALAFAGRLSFNPLTDELIGSDGKPFK FSDPSGNELPPRGYDPGEDTFQPPPQDRASVQVAIDPKSDRLQVLTPFKPWDGKTPSDLPVLIKVKGKCTTDHIS AGGPWLKYRGHLENISQNCLIGAINAENGEANKIKNQFTGEYDGVPQTAAYYRERGIKWVVIGDHNYGEGSSREH AALEPRFLGGLAIIVRSFARIHETNLKKQGMLALTFADPADYDKVRPDDKVDILGLESFAPGKNLTLLAKHADGT QEKFPLAHSFNEGQIEWFKAGSALNLMAAKAKSA* |
Coding | >AgabiH97|031470 ATGTACAACCTTGCTCACAAGTCCGCCCATGCCGCCCGCGCTGCAAAGCGTATGGCTGCGGGTATGGCCACCGCA GCTCCACGTATCGGTGACACCAAAGTCGCTATGTCAGCGTTTGAAAAGGATGCGTTTATCAACTATCAGCGCATC GAGGATAACCTTGCCGTTGTTCGCAACAGGCTAAAGCGCCCCTTGACTCTGTCTGAAAAAGTTGTCTATGGACAT CTTGATGATCCCCATGGTCAGGACATCAACCGCGGTGTCAGCTACCTCAAACTTCGTCCAGACCGTGTTGCCTGC CAGGACGCTACAGCACAGATGGCATTGCTTCAATTCATGTCTGCTGGTATGGACACGGCTGCCGTACCCACCACA GTACACTGCGACCATCTTATTGAGGCCCAGATTGGTGGTGTCAAGGATCTACAGCGCGCTATTCAAACAAACAAG GAAGTTTACGATTTCCTCGCTACTGCCACCGCAAAATATGGCCTTGGCTTCTGGAAACCAGGTTCCGGTATTATT CATCAGATTCTTCTCGAAAACTATGCATTCCCTGGTGGCATGATGATTGGTACAGACTCGCATACGCCCAACGCT GGTGGTCTCGGCATGGTTGCTTGTGGTGTTGGGGGTGCCGACGCTGTCGATGTGATGGCCGGTATACCATGGGAG CTTAAATGTCCCAAGGTCATTGGTGTTAACCTCACTGGAAAAATTGGCGGTTGGACTACTCCAAAGGATGTCATT CTCAAGGTTGCTGGTATTCTCACCGTCAAAGGCGGAACTGGCGCCATCGTTGAATATAAGGGCCCCGGTGTCGAG TCTCTTTCCTGCACGGGTATGGCGACAATCTGCAACATGGGTGCGGAAATTGGGGCAACGACGTCTCTGTTCCCG TTCAATCGCCGCATGGTCGACTATCTACAAGCCACTAAACGGTCTGACATCGCAAACTACGCCAAGGCCTTTGCG CACAACTTGCAAGCCGATGAGGCGGCCGAGTACGATGAGCATATCGAGATCAATCTTTCCGAGCTCGAACCTCAC ATCAACGGTCCCTTTACACCTGATCTAGCCACTCCTATCTCCAAGTTTGCCTCGGAGGCCAAGAAGAATGGCTGG CCTGAAGAAGTCAAAGTTGGTCTCATCGGTTCCTGCACCAACTCGTCATACGAGGATATGACTCGCTCTGCATCT ATCGTCAAGCAAGCTGCCGACCGCGGAATTGATTTCAAGAGCAAATTCACGGTTACCCCCGGATCCGAGCAAGTT CGTGCTACGATTGCTCGTGATGGGCTCATCGACTCTTTTGAAGGCGCTGGCGCAATAGTACTCGCCAATGCCTGT GGTCCTTGCATTGGTCAGTGGGATAGGCAGGATGTCAAGAAGGGTGAAGTCAATTCCATCGTAACTTCTTACAAT CGCAATTTCACTGGCCGTAATGATGCGAACCCTGCTACGCATGCCTTTGTTGCCTCTCCCGACATCACCACTGCC CTCGCGTTTGCTGGCCGCCTCAGCTTCAACCCGCTCACGGATGAGCTCATTGGCAGTGATGGCAAACCATTCAAG TTCTCAGACCCCAGTGGCAATGAGTTGCCTCCCCGTGGCTATGATCCCGGAGAGGACACCTTCCAACCCCCTCCC CAAGACCGCGCCAGTGTTCAGGTTGCCATCGACCCGAAGTCTGATCGTCTCCAGGTCCTCACACCCTTCAAGCCT TGGGATGGCAAGACTCCCAGTGATCTTCCCGTTCTCATCAAGGTCAAGGGCAAATGCACAACCGATCACATCTCT GCCGGTGGTCCATGGTTGAAGTACCGTGGACATCTGGAGAACATCTCTCAGAACTGTCTGATTGGTGCCATCAAC GCGGAGAACGGAGAAGCCAACAAGATCAAGAACCAGTTCACAGGAGAGTACGACGGTGTTCCGCAAACTGCTGCA TACTATCGTGAACGTGGGATCAAATGGGTCGTCATCGGAGACCACAACTACGGTGAAGGTTCTTCTCGTGAACAT GCTGCACTGGAGCCCCGCTTCCTCGGTGGCCTTGCCATCATTGTCCGTTCCTTTGCTCGCATCCACGAGACGAAC TTGAAGAAGCAGGGTATGCTCGCTTTGACCTTCGCCGATCCCGCCGACTATGATAAAGTTCGTCCCGATGACAAG GTTGATATCCTTGGTCTCGAGAGCTTTGCTCCCGGAAAAAATTTGACATTGTTAGCTAAGCACGCCGATGGTACT CAAGAGAAATTCCCGCTCGCACATTCCTTCAATGAGGGTCAGATCGAGTGGTTCAAGGCCGGTTCTGCATTGAAT CTCATGGCAGCCAAGGCCAAGTCAGCATAA |
Transcript | >AgabiH97|031470 ATGTACAACCTTGCTCACAAGTCCGCCCATGCCGCCCGCGCTGCAAAGCGTATGGCTGCGGGTATGGCCACCGCA GCTCCACGTATCGGTGACACCAAAGTCGCTATGTCAGCGTTTGAAAAGGATGCGTTTATCAACTATCAGCGCATC GAGGATAACCTTGCCGTTGTTCGCAACAGGCTAAAGCGCCCCTTGACTCTGTCTGAAAAAGTTGTCTATGGACAT CTTGATGATCCCCATGGTCAGGACATCAACCGCGGTGTCAGCTACCTCAAACTTCGTCCAGACCGTGTTGCCTGC CAGGACGCTACAGCACAGATGGCATTGCTTCAATTCATGTCTGCTGGTATGGACACGGCTGCCGTACCCACCACA GTACACTGCGACCATCTTATTGAGGCCCAGATTGGTGGTGTCAAGGATCTACAGCGCGCTATTCAAACAAACAAG GAAGTTTACGATTTCCTCGCTACTGCCACCGCAAAATATGGCCTTGGCTTCTGGAAACCAGGTTCCGGTATTATT CATCAGATTCTTCTCGAAAACTATGCATTCCCTGGTGGCATGATGATTGGTACAGACTCGCATACGCCCAACGCT GGTGGTCTCGGCATGGTTGCTTGTGGTGTTGGGGGTGCCGACGCTGTCGATGTGATGGCCGGTATACCATGGGAG CTTAAATGTCCCAAGGTCATTGGTGTTAACCTCACTGGAAAAATTGGCGGTTGGACTACTCCAAAGGATGTCATT CTCAAGGTTGCTGGTATTCTCACCGTCAAAGGCGGAACTGGCGCCATCGTTGAATATAAGGGCCCCGGTGTCGAG TCTCTTTCCTGCACGGGTATGGCGACAATCTGCAACATGGGTGCGGAAATTGGGGCAACGACGTCTCTGTTCCCG TTCAATCGCCGCATGGTCGACTATCTACAAGCCACTAAACGGTCTGACATCGCAAACTACGCCAAGGCCTTTGCG CACAACTTGCAAGCCGATGAGGCGGCCGAGTACGATGAGCATATCGAGATCAATCTTTCCGAGCTCGAACCTCAC ATCAACGGTCCCTTTACACCTGATCTAGCCACTCCTATCTCCAAGTTTGCCTCGGAGGCCAAGAAGAATGGCTGG CCTGAAGAAGTCAAAGTTGGTCTCATCGGTTCCTGCACCAACTCGTCATACGAGGATATGACTCGCTCTGCATCT ATCGTCAAGCAAGCTGCCGACCGCGGAATTGATTTCAAGAGCAAATTCACGGTTACCCCCGGATCCGAGCAAGTT CGTGCTACGATTGCTCGTGATGGGCTCATCGACTCTTTTGAAGGCGCTGGCGCAATAGTACTCGCCAATGCCTGT GGTCCTTGCATTGGTCAGTGGGATAGGCAGGATGTCAAGAAGGGTGAAGTCAATTCCATCGTAACTTCTTACAAT CGCAATTTCACTGGCCGTAATGATGCGAACCCTGCTACGCATGCCTTTGTTGCCTCTCCCGACATCACCACTGCC CTCGCGTTTGCTGGCCGCCTCAGCTTCAACCCGCTCACGGATGAGCTCATTGGCAGTGATGGCAAACCATTCAAG TTCTCAGACCCCAGTGGCAATGAGTTGCCTCCCCGTGGCTATGATCCCGGAGAGGACACCTTCCAACCCCCTCCC CAAGACCGCGCCAGTGTTCAGGTTGCCATCGACCCGAAGTCTGATCGTCTCCAGGTCCTCACACCCTTCAAGCCT TGGGATGGCAAGACTCCCAGTGATCTTCCCGTTCTCATCAAGGTCAAGGGCAAATGCACAACCGATCACATCTCT GCCGGTGGTCCATGGTTGAAGTACCGTGGACATCTGGAGAACATCTCTCAGAACTGTCTGATTGGTGCCATCAAC GCGGAGAACGGAGAAGCCAACAAGATCAAGAACCAGTTCACAGGAGAGTACGACGGTGTTCCGCAAACTGCTGCA TACTATCGTGAACGTGGGATCAAATGGGTCGTCATCGGAGACCACAACTACGGTGAAGGTTCTTCTCGTGAACAT GCTGCACTGGAGCCCCGCTTCCTCGGTGGCCTTGCCATCATTGTCCGTTCCTTTGCTCGCATCCACGAGACGAAC TTGAAGAAGCAGGGTATGCTCGCTTTGACCTTCGCCGATCCCGCCGACTATGATAAAGTTCGTCCCGATGACAAG GTTGATATCCTTGGTCTCGAGAGCTTTGCTCCCGGAAAAAATTTGACATTGTTAGCTAAGCACGCCGATGGTACT CAAGAGAAATTCCCGCTCGCACATTCCTTCAATGAGGGTCAGATCGAGTGGTTCAAGGCCGGTTCTGCATTGAAT CTCATGGCAGCCAAGGCCAAGTCAGCATAA |
Gene | >AgabiH97|031470 ATGTACAACCTTGCTCACAAGTCCGCCCATGCCGCCCGCGCTGCAAAGCGTATGGCTGCGGGTATGGCCACCGCA GCTCCACGTATCGGTGACACCAAAGTCGCTATGTCAGCGTTTGAAAAGGATGCGTTTATCAACTATCAGCGCATC GAGGATAACCTTGCCGTTGTTCGCAACAGGTTTGTCTGTTCATCCTGCTGTATTCACGTTCTAACGTACTTTCAG GCTAAAGCGCCCCTTGACTCTGTCTGAAAAAGTTGTCTATGGACATCTTGATGATCCCCATGGTCAGGACATCAA CCGCGGTGTCAGCTACCTCAAACTTCGTCCAGACGTATGTACCACTGCAATCACTGTACCTTCCTCAACTCCTGA ATCTACCATGCCCCGTACAGCGTGTTGCCTGCCAGGACGCTACAGCACAGGTTCGAACTCATTCTCTATGTCAGT GTGGCCCCTGTGACGTAATGTATCTCTAGATGGCATTGCTTCAATTCATGTCTGCTGGTATGGACACGGCTGCCG TACCCACCACAGTACACTGCGACCATCTTATTGAGGCCCAGATTGGTGGTGTCAAGGATCTACAGCGCGCTATTC AAACAAACAAGGAAGTTTACGATTTCCTCGCTACTGCCACCGCAAAATATGGCCTTGGCTTCTGGAAACCAGGTT CCGGTATTATTCATCAGATTCTTCTCGAAAACTATGCATTCCCTGGTGGCATGATGATTGGTACAGACTCGCATA CGCCCAACGCTGGTGGTCTCGGCATGGTTGCTTGTGGTGTTGGGGGTGCCGACGCTGTCGATGTGATGGCCGGTA TACCATGGGAGCTTAAATGTCCCAAGGTCATTGGTGTTAACCTCACTGGAAAAATTGGCGGTTGGACTACTCCAA AGGGTTGGTGACCTTGCATTCTGGTCTGTTGCCCTTCTGACGTCATGCTGTAGATGTCATTCTCAAGGTTGCTGG TATTCTCACCGTCAAAGGCGGAACTGGCGCCATCGTTGAATATAAGGGCCCCGGTGTCGAGTCTCTTTCCTGCAC GGGTATGGCGACAATCTGCAACATGGGTGCGGAAATTGGGGCAACGACGTCTCTGTTCCCGTTCAATCGCCGCAT GGTCGACTATCTACAAGCCACTAAACGGTCTGACATCGCAAACTACGCCAAGGCCTTTGCGCACAACTTGCAAGC CGATGAGGCGGCCGAGTACGATGAGCATATCGAGATCGTGAGTGTTGCAGGGAATGTCTTGACACTCAATGTAAC GCTTTACTAGAATCTTTCCGAGCTCGAACCTCACATCAACGGTCCCTTTACACCTGATCTAGCCACTCCTATCTC CAAGTTTGCCTCGGAGGCCAAGAAGAATGGCTGGCCTGAAGAAGTCAAAGTTGGTCTCATCGGTTCCTGCACCAA CTCGTCATACGAGGATATGACTCGCTCTGCATCTATCGTCAAGCAAGCTGCCGACCGCGGAATTGATTTCAAGAG CAAATTCACGGTTACCCCCGGATCCGAGCAAGTTCGTGCTACGATTGCTCGTGATGGGCTCATCGACTCTTTTGA AGGCGCTGGCGCAATAGTACTCGCCAATGCCTGTGGTCCTTGCATTGGTCAGTGGGATAGGCAGGATGTCAAGAA GGGTGAAGTCAATTCCAGTGAGTCGTTGGTGTGTTGCGCAATAAGGGGGTTCGACTGACGACGTTCTTTATAGTC GTAACTTCTTACAATCGCAATTTCACTGGCCGTAATGATGCGAACCCTGCTACGCATGCCTTTGTTGCCTCTCCC GACATCACCACTGCCCTCGCGTTTGCTGGCCGCCTCAGCTTCAACCCGCTCACGGATGAGCTCATTGGCAGTGAT GGCAAACCATTCAAGTTCTCAGACCCCAGTGGCAATGAGTTGCCTCCCCGTGGCTATGATCCCGGAGAGGACACC TTCCAACCCCCTCCCCAAGACCGCGCCAGTGTTCAGGTTGCCATCGACCCGAAGTCTGATCGTCTCCAGGTCCTC ACACCCTTCAAGCCTTGGGATGGCAAGACTCCCAGTGATCTTCCCGTTCTCATCAAGGTCAAGGGCAAATGCACA ACCGATCACATCTCTGCCGGTGGTCCATGGTTGAAGTACCGTGGACATCTGGAGAACATCTCTCAGAACTGTCTG ATTGGTGCCATCAACGCGGAGAACGGAGAAGCCAACAAGATCAAGAACCAGTTCACAGGAGAGTACGACGGTGTT CCGCAAACTGCTGCATACTATCGTGAACGTGGGATCAAATGGGTCGTCATCGGAGACCACAACTACGGTGAAGGT TCTTCTCGTGAACATGCTGCACTGGAGCCCCGCTTCCTCGGTGGCCTTGCCATCATTGTCCGTTCCTTTGCTCGC ATCCACGAGACGAACTTGAAGAAGCAGGGTATGCTCGCTTTGACCTTCGCCGATCCCGCCGACTATGATAAAGTT CGTCCCGATGACAAGGTTGATATCCTTGGTCTCGAGAGCTTTGCTCCCGGAAAAAATTTGACATTGTTAGCTAAG CACGCCGATGGTACTCAAGAGGTAAGTGTACTAGCTTCAATTAGTTTTAACATTGTAACTCATTCGTTTTTAGAA ATTCCCGCTCGCACATTCCTTCAATGAGGGTCAGATCGAGTGGTTCAAGGCCGGTTCTGCATTGAATCTCATGGC AGCCAAGGCCAAGTCAGCATAA |