Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031350
Gene name
Locationscaffold_12:872772..876485
Strand+
Gene length (bp)3713
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.2E-76 442 716
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.1E-36 39 224
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 3.9E-35 246 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 16 787 4.0E-86
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 41 758 3.0E-80
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 88 794 2.0E-45
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 88 812 5.0E-45
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 39 780 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 16 787 4.0E-86
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 41 758 3.0E-80
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 88 794 2.0E-45
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 88 812 5.0E-45
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 39 780 1.0E-44
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 77 748 1.0E-43
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 40 905 3.0E-43
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 39 780 4.0E-42
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 43 748 2.0E-41
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 88 719 3.0E-41
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 67 748 5.0E-41
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 391 772 5.0E-41
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 343 717 7.0E-39
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 90 771 2.0E-36
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 56 773 2.0E-36
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 88 808 8.0E-34
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 41 772 3.0E-32
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 207 765 1.0E-30
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 45 749 1.0E-28
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 90 783 2.0E-26
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 28 782 4.0E-26
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 365 747 3.0E-16
sp|Q91YT8|CSCL1_MOUSE CSC1-like protein 1 OS=Mus musculus GN=Tmem63a PE=1 SV=1 91 683 1.0E-13
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 91 750 3.0E-13
sp|Q5T3F8|CSCL2_HUMAN CSC1-like protein 2 OS=Homo sapiens GN=TMEM63B PE=1 SV=1 190 683 7.0E-12
sp|Q3TWI9|CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus GN=Tmem63b PE=1 SV=1 190 683 7.0E-12
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 91 683 8.0E-12
sp|Q8CBX0|CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus GN=Tmem63c PE=1 SV=1 185 734 7.0E-11
sp|Q9P1W3|CSC1_HUMAN Calcium permeable stress-gated cation channel 1 OS=Homo sapiens GN=TMEM63C PE=2 SV=1 247 737 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 115 137 22
3 204 223 19
4 445 467 22
5 498 520 22
6 537 559 22
7 591 613 22
8 633 655 22
9 659 681 22
10 694 716 22
11 720 742 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031350
MAAAAVLVVALAHAVAAADDDRNLPPGSPPLRKFQGPWFTTQLTISATIGITSFLLFSYCRTRWPLVFAPRTKLK
GFSPHEAHAHQAFFGWIMPTIRTSEFTVLQIVGLDAAVLLNFFKTAFQLFSVCSLFAITILMPLNWKQNKYPTDD
GDEDWPDDQDDWPIFLRPSLYKRPGTLESQNPGSNSTFPGRDWLDLISDADSYLSIHLIFTYLFTILALYFLYKN
YRRFIRSRQLFSLELVHSIPARTVLVTDLPKHLQGERTLAEYFENMNLAVESVTVCREVGSLKALLDRRTDALLQ
LEKAWVDYVGNPSTVEEYDPETNAMPLIDADIEGGGTSKFVVPHKPRPTLRPGWFQPKVDALEYLEKKFKDADDA
VKKKRRTGKFRATGSAFVTFEKMSSAQIAIQVTHATNAFQLTTYPAPEPRDIVWANMTSPTSVIRTRDVIVVLLM
ILLLFFWFIPITGLASLLSYKEIKKAMPWLGVLIDRNEQVRAIVQNSLPSVAMITLNALLPFMLEALTYVQGYRA
RSWVEYSLLKKYFLFLLINVVFIFLLATTYWQLVRDLANSPAKVPEKLALALQAGSARHFFLSYVILQGIGIMPL
QLLNLGVIIPRFFFRLFLTRTPRDFAELNAPPVINYGVVYPQAILMFVITMLYSVQQPLIVIFGAVYFGVGYVVY
KYKLLFVFYKPYESQGQAWPITFIRLIWGVVIFLVFMIGIFSLRTYWTLSSLLIPLLMGTVAWSWYIDKKLKPLS
KHVSLSSIFEVQRGEETADVMRLRAGHPVTWSQSNLNRRRYAQNDDTLYVAPEDERTDYSQPPMANWYSGVLNTG
KRRYGHPALNGVLPEPWLPLKKGQTLVNNDNNNQHTRDNGQTVVLTLRKRYNTLRGRNRTGQESVPPTPHTDNGD
AQEIPTDAAAVANPWGDIRPTNRRVQHSAPLHHRLSFDHGSGVIVLPEDGDWLDLHDDDEVDSDEDHHTHEHETN
NDGNLDQSIASLASAESTAPTPGPGISSPSRTSRYGTYFHHPERRKQSIPGAFPGR*
Coding >AgabiH97|031350
ATGGCTGCCGCGGCCGTCCTCGTCGTCGCCCTCGCCCACGCCGTCGCCGCCGCAGACGATGACCGCAACCTACCG
CCCGGCTCGCCCCCGCTGCGCAAGTTTCAAGGGCCATGGTTTACCACCCAGCTCACCATCTCTGCCACCATCGGC
ATTACCTCGTTTCTTCTCTTTTCCTACTGCCGCACGCGCTGGCCACTTGTCTTTGCTCCCCGTACAAAGCTAAAG
GGCTTTTCTCCACACGAGGCGCATGCACACCAGGCTTTCTTCGGATGGATAATGCCTACAATCAGGACTTCCGAG
TTTACTGTACTCCAAATTGTAGGCTTAGATGCCGCAGTACTTCTCAATTTTTTCAAGACCGCCTTTCAGCTCTTC
TCTGTATGTTCGCTGTTCGCCATCACCATTCTCATGCCACTCAATTGGAAGCAAAACAAGTATCCGACTGACGAT
GGAGACGAAGATTGGCCCGATGATCAAGACGACTGGCCAATCTTTCTCCGTCCATCTCTTTACAAACGTCCGGGG
ACTCTCGAGAGCCAAAATCCTGGTTCCAATTCTACGTTCCCTGGACGCGACTGGCTTGACCTGATCAGCGATGCC
GACTCATACCTCTCTATCCACCTTATCTTCACCTACCTCTTCACCATACTTGCTCTCTACTTTCTCTACAAGAAC
TACCGCCGCTTCATTCGTTCTCGCCAGCTCTTTTCACTCGAACTTGTGCATTCTATTCCGGCTCGCACCGTTCTC
GTCACCGACCTTCCCAAACACCTTCAAGGCGAGCGAACCCTTGCCGAATATTTTGAGAACATGAACCTGGCCGTA
GAGAGTGTCACCGTCTGTCGTGAGGTGGGAAGTCTCAAAGCGTTGCTGGATCGTAGGACAGACGCACTTTTACAA
CTGGAAAAAGCCTGGGTTGACTACGTCGGAAACCCAAGTACAGTCGAAGAATACGACCCAGAAACCAATGCTATG
CCCCTCATTGACGCTGATATCGAGGGTGGTGGGACATCCAAGTTTGTCGTTCCGCACAAACCTCGTCCGACTCTA
CGGCCTGGTTGGTTTCAGCCGAAAGTCGATGCATTGGAGTATTTGGAAAAGAAATTCAAGGATGCAGACGACGCC
GTCAAGAAGAAAAGGCGGACTGGCAAGTTTAGGGCCACTGGGTCGGCATTTGTTACGTTCGAGAAAATGTCAAGT
GCTCAAATCGCTATCCAAGTAACCCATGCCACTAACGCCTTCCAACTCACAACCTACCCTGCCCCTGAGCCTCGC
GACATCGTGTGGGCGAATATGACGTCTCCGACTTCAGTCATCCGTACTCGGGACGTCATAGTAGTGCTTCTCATG
ATTCTATTATTATTCTTTTGGTTCATCCCCATTACCGGGCTGGCTAGTCTGCTCAGTTACAAAGAGATAAAGAAG
GCTATGCCCTGGCTTGGTGTACTCATTGACAGGAACGAGCAAGTCCGAGCAATTGTACAAAACTCGTTACCGTCA
GTCGCCATGATTACGCTGAATGCCTTACTCCCATTCATGCTTGAAGCTTTGACCTATGTCCAAGGTTACAGGGCT
CGGAGTTGGGTGGAGTACTCACTCTTGAAGAAATACTTCTTGTTCCTCTTAATCAACGTCGTATTTATCTTTTTA
CTGGCAACAACGTACTGGCAACTCGTACGGGACCTTGCAAATTCCCCTGCCAAGGTCCCGGAAAAGCTGGCTTTG
GCGTTGCAGGCTGGTTCGGCGCGTCACTTCTTTTTATCCTATGTAATTCTGCAGGGTATTGGTATCATGCCTCTT
CAGCTGCTAAATCTGGGTGTAATTATACCGCGCTTCTTCTTCCGCCTTTTCTTGACAAGGACCCCTCGAGATTTT
GCAGAGCTCAATGCTCCCCCAGTCATTAATTATGGCGTCGTGTACCCCCAGGCCATACTGATGTTTGTGATCACG
ATGCTATATAGTGTTCAACAACCTCTTATAGTCATCTTCGGAGCCGTATATTTTGGCGTTGGATATGTTGTGTAC
AAGTACAAACTTCTTTTCGTATTCTACAAACCGTACGAATCGCAGGGCCAAGCATGGCCCATCACGTTCATTCGA
CTCATCTGGGGGGTCGTCATCTTCCTAGTATTTATGATTGGTATCTTCAGTTTGAGGACCTACTGGACCCTCTCA
TCATTATTGATCCCTTTGCTCATGGGGACTGTCGCGTGGTCATGGTATATTGACAAGAAGTTGAAACCACTGAGC
AAGCATGTCAGCCTGAGTTCGATATTTGAAGTTCAAAGGGGAGAAGAGACGGCCGATGTGATGAGGCTGAGAGCT
GGGCACCCTGTCACTTGGTCTCAGAGCAACTTAAACCGGCGAAGATATGCGCAAAATGATGATACACTTTACGTC
GCTCCAGAAGATGAGCGCACTGACTATTCGCAACCGCCGATGGCGAATTGGTATAGCGGCGTCCTGAACACTGGT
AAACGACGTTATGGTCACCCGGCTCTCAATGGCGTACTCCCCGAGCCGTGGCTTCCTCTGAAGAAAGGTCAAACA
TTGGTGAACAATGACAACAACAACCAACATACCCGGGACAATGGACAAACTGTGGTTCTCACTCTGCGAAAACGC
TATAACACATTACGAGGCCGTAATCGAACAGGTCAAGAATCCGTGCCCCCAACTCCGCATACAGACAATGGCGAC
GCACAAGAGATACCTACAGACGCAGCTGCAGTTGCGAACCCATGGGGCGATATCCGACCCACCAACCGACGAGTC
CAACATTCTGCACCCCTTCATCATCGACTAAGCTTTGATCACGGTTCTGGAGTCATTGTGCTACCAGAAGACGGA
GATTGGCTGGACCTGCATGATGATGATGAGGTTGATAGTGACGAAGACCATCATACACATGAGCATGAAACGAAT
AACGATGGAAATTTAGACCAGAGCATTGCATCCTTGGCGAGTGCAGAATCGACTGCTCCGACACCCGGACCGGGG
ATATCGAGTCCTTCGAGGACGTCGAGATACGGAACCTACTTCCACCATCCGGAGAGACGAAAACAGTCGATACCG
GGTGCTTTTCCAGGGCGGTAG
Transcript >AgabiH97|031350
ATGGCTGCCGCGGCCGTCCTCGTCGTCGCCCTCGCCCACGCCGTCGCCGCCGCAGACGATGACCGCAACCTACCG
CCCGGCTCGCCCCCGCTGCGCAAGTTTCAAGGGCCATGGTTTACCACCCAGCTCACCATCTCTGCCACCATCGGC
ATTACCTCGTTTCTTCTCTTTTCCTACTGCCGCACGCGCTGGCCACTTGTCTTTGCTCCCCGTACAAAGCTAAAG
GGCTTTTCTCCACACGAGGCGCATGCACACCAGGCTTTCTTCGGATGGATAATGCCTACAATCAGGACTTCCGAG
TTTACTGTACTCCAAATTGTAGGCTTAGATGCCGCAGTACTTCTCAATTTTTTCAAGACCGCCTTTCAGCTCTTC
TCTGTATGTTCGCTGTTCGCCATCACCATTCTCATGCCACTCAATTGGAAGCAAAACAAGTATCCGACTGACGAT
GGAGACGAAGATTGGCCCGATGATCAAGACGACTGGCCAATCTTTCTCCGTCCATCTCTTTACAAACGTCCGGGG
ACTCTCGAGAGCCAAAATCCTGGTTCCAATTCTACGTTCCCTGGACGCGACTGGCTTGACCTGATCAGCGATGCC
GACTCATACCTCTCTATCCACCTTATCTTCACCTACCTCTTCACCATACTTGCTCTCTACTTTCTCTACAAGAAC
TACCGCCGCTTCATTCGTTCTCGCCAGCTCTTTTCACTCGAACTTGTGCATTCTATTCCGGCTCGCACCGTTCTC
GTCACCGACCTTCCCAAACACCTTCAAGGCGAGCGAACCCTTGCCGAATATTTTGAGAACATGAACCTGGCCGTA
GAGAGTGTCACCGTCTGTCGTGAGGTGGGAAGTCTCAAAGCGTTGCTGGATCGTAGGACAGACGCACTTTTACAA
CTGGAAAAAGCCTGGGTTGACTACGTCGGAAACCCAAGTACAGTCGAAGAATACGACCCAGAAACCAATGCTATG
CCCCTCATTGACGCTGATATCGAGGGTGGTGGGACATCCAAGTTTGTCGTTCCGCACAAACCTCGTCCGACTCTA
CGGCCTGGTTGGTTTCAGCCGAAAGTCGATGCATTGGAGTATTTGGAAAAGAAATTCAAGGATGCAGACGACGCC
GTCAAGAAGAAAAGGCGGACTGGCAAGTTTAGGGCCACTGGGTCGGCATTTGTTACGTTCGAGAAAATGTCAAGT
GCTCAAATCGCTATCCAAGTAACCCATGCCACTAACGCCTTCCAACTCACAACCTACCCTGCCCCTGAGCCTCGC
GACATCGTGTGGGCGAATATGACGTCTCCGACTTCAGTCATCCGTACTCGGGACGTCATAGTAGTGCTTCTCATG
ATTCTATTATTATTCTTTTGGTTCATCCCCATTACCGGGCTGGCTAGTCTGCTCAGTTACAAAGAGATAAAGAAG
GCTATGCCCTGGCTTGGTGTACTCATTGACAGGAACGAGCAAGTCCGAGCAATTGTACAAAACTCGTTACCGTCA
GTCGCCATGATTACGCTGAATGCCTTACTCCCATTCATGCTTGAAGCTTTGACCTATGTCCAAGGTTACAGGGCT
CGGAGTTGGGTGGAGTACTCACTCTTGAAGAAATACTTCTTGTTCCTCTTAATCAACGTCGTATTTATCTTTTTA
CTGGCAACAACGTACTGGCAACTCGTACGGGACCTTGCAAATTCCCCTGCCAAGGTCCCGGAAAAGCTGGCTTTG
GCGTTGCAGGCTGGTTCGGCGCGTCACTTCTTTTTATCCTATGTAATTCTGCAGGGTATTGGTATCATGCCTCTT
CAGCTGCTAAATCTGGGTGTAATTATACCGCGCTTCTTCTTCCGCCTTTTCTTGACAAGGACCCCTCGAGATTTT
GCAGAGCTCAATGCTCCCCCAGTCATTAATTATGGCGTCGTGTACCCCCAGGCCATACTGATGTTTGTGATCACG
ATGCTATATAGTGTTCAACAACCTCTTATAGTCATCTTCGGAGCCGTATATTTTGGCGTTGGATATGTTGTGTAC
AAGTACAAACTTCTTTTCGTATTCTACAAACCGTACGAATCGCAGGGCCAAGCATGGCCCATCACGTTCATTCGA
CTCATCTGGGGGGTCGTCATCTTCCTAGTATTTATGATTGGTATCTTCAGTTTGAGGACCTACTGGACCCTCTCA
TCATTATTGATCCCTTTGCTCATGGGGACTGTCGCGTGGTCATGGTATATTGACAAGAAGTTGAAACCACTGAGC
AAGCATGTCAGCCTGAGTTCGATATTTGAAGTTCAAAGGGGAGAAGAGACGGCCGATGTGATGAGGCTGAGAGCT
GGGCACCCTGTCACTTGGTCTCAGAGCAACTTAAACCGGCGAAGATATGCGCAAAATGATGATACACTTTACGTC
GCTCCAGAAGATGAGCGCACTGACTATTCGCAACCGCCGATGGCGAATTGGTATAGCGGCGTCCTGAACACTGGT
AAACGACGTTATGGTCACCCGGCTCTCAATGGCGTACTCCCCGAGCCGTGGCTTCCTCTGAAGAAAGGTCAAACA
TTGGTGAACAATGACAACAACAACCAACATACCCGGGACAATGGACAAACTGTGGTTCTCACTCTGCGAAAACGC
TATAACACATTACGAGGCCGTAATCGAACAGGTCAAGAATCCGTGCCCCCAACTCCGCATACAGACAATGGCGAC
GCACAAGAGATACCTACAGACGCAGCTGCAGTTGCGAACCCATGGGGCGATATCCGACCCACCAACCGACGAGTC
CAACATTCTGCACCCCTTCATCATCGACTAAGCTTTGATCACGGTTCTGGAGTCATTGTGCTACCAGAAGACGGA
GATTGGCTGGACCTGCATGATGATGATGAGGTTGATAGTGACGAAGACCATCATACACATGAGCATGAAACGAAT
AACGATGGAAATTTAGACCAGAGCATTGCATCCTTGGCGAGTGCAGAATCGACTGCTCCGACACCCGGACCGGGG
ATATCGAGTCCTTCGAGGACGTCGAGATACGGAACCTACTTCCACCATCCGGAGAGACGAAAACAGTCGATACCG
GGTGCTTTTCCAGGGCGGTAG
Gene >AgabiH97|031350
ATGGCTGCCGCGGCCGTCCTCGTCGTCGCCCTCGCCCACGCCGTCGCCGCCGCAGACGATGACCGCAACCTACCG
CCCGGCTCGCCCCCGCTGCGTATGTTCCTCGCATACGATTCATATCCTCTCTGACCGTCTCCACAGGCAAGTTTC
AAGGGCCATGGTTTACCACCCAGCTCACCATCTCTGCCACCATCGGCATTACCTCGTTTCTTCTCTTTTCCTACT
GCCGCACGCGCTGGCCACTTGTCTTTGCTCCCCGTACAAAGCTAAAGGGTACGTCGGCCCCAAACTCTCTCCATC
TCCGTACTTATCCCTGACACAGGCTTTTCTCCACACGAGGCGCATGCACACCAGGCTTTCTTCGGATGGATAATG
CCTACAATCAGGACTTCCGAGTTTACTGTACTCCAAATTGTAGGCTTAGATGCCGCAGTAGTACGTCCCACTCCC
CCCATTTAACTCAGACGACACAAATCTTACATCACTCAGCTTCTCAATTTTTTCAAGACCGCCTTTCAGCTCTTC
TCTGTATGTTCGCTGTTCGCCATCACCATTCTCATGCCACTCAATTGGAAGGCAAGCTCGTTGTCCTTCTTGTTA
GCTAAACTTATCTCATACAATCCCATCAGCAAAACAAGTATCCGACTGACGATGGAGACGAAGATTGGCCCGATG
ATCAAGACGACTGGCCAATCTTTCTCCGTCCATCTCTTTACAAACGTCCGGGGACTCTCGAGAGCCAAAATCCTG
GTTCCAATTCTACGTTCCCTGGACGCGACTGGCTTGACCTGATCAGCGATGCCGACTCATACCTCTCTATCCACC
TTATCTTCACCTACCTCTTCACCATACTTGCTCTCTACTTTCTCTACAAGAACTACCGCCGCTTCATTCGTTCTC
GCCAGCTCTTTTCACTCGAACTTGTGCATTCTATTCCGGCTCGCACCGTTCTCGTCACCGACCTTCCCAAACACC
TTCAAGGCGAGCGAACCCTTGCCGAATATTTTGAGAACATGAACCTGGCCGTAGAGAGTGTCACCGTCTGTCGTG
AGGTGGGAAGTCTCAAAGCGTTGCTGGATCGTAGGACAGACGCACTTTTACAACTGGAAAAAGCCTGGGTTGACT
ACGTCGGAAACCCAAGTACAGTCGAAGAATACGACCCAGAAACCAATGCTATGCCCCTCATTGACGCTGATATCG
AGGGTGGTGGGACATCCAAGTTTGTCGTTCCGCACAAACCTCGTCCGACTCTACGGCCTGGTTGGTTTCAGCCGA
AAGTCGATGCATTGGAGTATTTGGAAAAGAAATTCAAGGATGCAGACGACGCCGTCAAGAAGAAAAGGCGGACTG
GCAAGTTTAGGGCCACTGGGTCGGCATTTGTTACGTTCGAGAAAATGTCAAGTGCTGTAAGTTGTACCCGAATTA
TCAATGAATGTCATGCTCAAGCCTGCTTTAGCAAATCGCTATCCAAGTAACCCATGCCACTAACGCCTTCCAACT
CACAACCTACCCTGCCCCTGAGCCTCGCGACATCGTGTGGGCGAATATGACGTCTCCGACTTCAGTCATCCGTAC
TCGGGACGTCATAGTAGTGCTTCTCATGATTCTATTATTATTCTTTTGGTTCATCCCCATTACCGGGCTGGCTAG
TCTGCTCAGTTACAAAGAGATAAAGAAGGCTATGCCCTGGCTTGGTGTACTCATTGACAGGAACGAGCAAGTCCG
AGCAATTGTACAAAACTCGTTACCGTCAGTCGCCATGATTACGCTGAATGCCTTACTCCCATTCATGCTTGAAGG
TAAGCATATATGAGATGAAAGATAGTTAATGGAGCTGACTTTGGGTAGCTTTGACCTATGTCCAAGGTTACAGGG
CTCGGAGTTGGGTGGAGTACTCACTCTTGAAGAAGTGAGTACAATTTACGTGTGAATGGCACTGATAATATTGAC
ATTTCGTCAGATACTTCTTGTTCCTCTTAATCAACGTCGTATTTATCTTTTTACTGGCAACAACGTACTGGCAAC
TCGTACGGGACCTTGCAAATTCCCCTGCCAAGGTCCCGGAAAAGCTGGCTTTGGCGTTGCAGGCTGGTTCGGCGC
GTCACTTCTTTTTATCCTATGTAATTCTGCAGGGTATTGGTATCATGCCTCTTCAGCTGCTAAATCTGGGTGTAA
TTATACCGCGCTTCTTCTTCCGCCTTTTCTTGACAAGGACCCCTCGAGGTAAGTGGTTAATTACTTGTATCTCAC
GCGACTTTGTATTAATCATCATATCATAGATTTTGCAGAGCTCAATGCTCCCCCAGTCATTAATTATGGCGTCGT
GTACCCCCAGGCCATACTGATGTTTGTGATCACGATGCTATATAGTGTTCAACAACCTCTTATAGTCATCTTCGG
AGCCGTATATTTTGGCGTTGGATATGTTGTGTACAAGTACAAACTTCTTTTCGGTGAGTACGTTTGTCACCAAAC
TGTGAAGCATCTATTGACTTCGTATAGTATTCTACAAACCGTACGAATCGCAGGGCCAAGCATGGCCCATCACGT
TCATTCGACTCATCTGGGGGGTCGTCATCTTCCTAGTATTTATGATTGGTATCTTCAGTTTGAGGACCTACTGGA
CCCTCTCATCATTATTGATCCCTTTGCTCATGGGGACTGTCGCGTGGTCATGGTATATTGACAAGAAGTTGAAAC
CACTGAGCAAGCATGTCAGCCTGAGTTCGATATTTGAAGTTCAAAGGGGAGAAGAGACGGCCGATGTGATGAGGC
TGAGAGCTGGGCACCCTGTCACTTGGTCTCAGAGGTATGTACCCAGGTACTTATTCCTTGAAGTCGACAGCTTGA
CTCACTGTTACTCAGCAACTTAAACCGGCGAAGATATGCGCAAAATGATGATACACTTTACGTCGCTCCAGAAGA
TGAGCGCACTGACTATGTGAGGACAATGCCCGTCTCAGGCACACTTCATTACTCATCAGTCTTCGTAGTCGCAAC
CGCCGATGGCGAATTGGTATAGCGGCGTCCTGAAGTGCGTACTCTTCTCGATTGCCATGACTTCCACTAATCTTG
AATGATACAGCACTGGTAAACGACGTTATGGTCACCCGGCTCTCAATGGCGTACTCCCCGAGCCGTGGCTTCCTC
TGAAGAAAGGTCAAACATTGGTGAACAATGACAACAACAACCAACATACCCGGGACAATGGACAAACTGTGGTTC
TCACTCTGCGAAAACGCTATAACACATTACGAGGCCGTAATCGAACAGGTCAAGAATCCGTGCCCCCAACTCCGC
ATACAGACAATGGCGACGCACAAGAGATACCTACAGACGCAGCTGCAGTTGCGAACCCATGGGGCGATATCCGAC
CCACCAACCGACGAGTCCAACATTCTGCACCCCTTCATCATCGACTAAGCTTTGATCACGGTTCTGGAGTCATTG
TGCTACCAGAAGACGGAGATTGGCTGGACCTGCATGATGATGATGAGGTTGATAGTGACGAAGACCATCATACAC
ATGAGCATGAAACGAATAACGATGGAAATTTAGACCAGAGCATTGCATCCTTGGCGAGTGCAGAATCGACTGCTC
CGACACCCGGACCGGGGATATCGAGTCCTTCGAGGACGTCGAGATACGGAACCTACTTCCACCATCCGGAGAGAC
GAAAACAGTCGATACCGGGTGCTTTTCCAGGGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail