Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|031340
Gene name
Locationscaffold_12:870836..872653
Strand-
Gene length (bp)1817
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.0E-65 171 448
PF08241 Methyltransf_11 Methyltransferase domain 9.4E-10 239 339
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-09 239 335
PF13489 Methyltransf_23 Methyltransferase domain 8.0E-08 218 347
PF08123 DOT1 Histone methylation protein DOT1 7.3E-06 216 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 2 481 0.0E+00
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 5 474 0.0E+00
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 5 470 9.0E-180
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 5 470 1.0E-172
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 171 436 5.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 2 481 0.0E+00
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 5 474 0.0E+00
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 5 470 9.0E-180
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 5 470 1.0E-172
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 171 436 5.0E-42
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 119 473 1.0E-38
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 181 460 6.0E-33
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 181 460 6.0E-33
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 178 452 3.0E-30
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 178 452 5.0E-30
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 178 452 5.0E-30
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 178 452 5.0E-30
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 178 452 5.0E-30
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 180 452 1.0E-29
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 180 452 1.0E-29
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 180 452 8.0E-28
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 180 452 8.0E-28
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 180 452 2.0E-27
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 178 452 3.0E-27
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 178 452 3.0E-27
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 178 452 3.0E-27
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 169 431 8.0E-27
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 169 431 8.0E-27
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 178 452 1.0E-26
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 178 452 2.0E-26
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 178 452 2.0E-26
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 178 452 2.0E-26
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 178 452 3.0E-26
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 178 452 3.0E-26
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 178 452 3.0E-26
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 169 431 3.0E-26
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 153 450 9.0E-21
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 210 442 1.0E-10
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 196 411 2.0E-09
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 214 415 2.0E-09
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 203 415 4.0E-09
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 209 365 2.0E-08
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 214 415 2.0E-07
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 210 415 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0018024 histone-lysine N-methyltransferase activity Yes
GO:0008170 N-methyltransferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016279 protein-lysine N-methyltransferase activity No
GO:0016740 transferase activity No
GO:0008276 protein methyltransferase activity No
GO:0042054 histone methyltransferase activity No
GO:0003824 catalytic activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0016278 lysine N-methyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 59 81 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|031340
MSSSVRVTDYPAIKNAPLVGLAEGNGSFNNIHLAGLVLTVPYLLKWFLPLFNRGGFKTYLFLLVLSGVPTTVAYW
TVMSHIGSRRNEKVALPGKDIEEYITINDEDLKRTYKRKDKIPMQIFHDAYFDGKIDFNGDVLDIMEQRHDWAKF
NFTMELFKYVFTVLIPCVISHSQTQDEEQVRDHYDRGDDFYGWFLGPRMIYTSGIIIKPDAEESLEELQDNKLAV
VCSKLDLQPEDRLLDIGCGWGTLVAYAAKNYECDATGVTLAKNQAKFGTDRIEKNGVPASRARILCSDYRDIPAG
TTYTKIVSLEMAEHVGVRRYSQFLSQVYDLLDDDGLFVFQVAGIRPSWQYEDLIWGLFMNKYVFPGADASCSLGW
VINKLEGAGFEVKNIDVLGVHYSATIYRWYQNWVSNKEAVIQAYGERWYRIWAFFLAYSVIISRQGGASVFQITL
HKNLNAFHRVQGVKSHASIHVKLDKEPELIE*
Coding >AgabiH97|031340
ATGTCGTCCTCTGTCCGTGTCACCGACTATCCTGCGATCAAGAACGCCCCCCTCGTCGGTCTCGCGGAGGGCAAT
GGCTCCTTCAACAACATCCACCTCGCCGGCCTCGTCCTCACCGTTCCTTACTTGCTCAAGTGGTTCCTTCCCTTA
TTTAACCGAGGCGGCTTCAAGACCTATCTCTTTCTCCTCGTCCTCTCCGGTGTCCCCACAACCGTCGCATACTGG
ACAGTTATGAGCCACATCGGTTCTCGCCGCAACGAAAAAGTCGCCCTTCCTGGCAAAGACATTGAAGAGTACATC
ACCATCAACGACGAAGACCTGAAGCGTACCTACAAGAGAAAAGACAAGATTCCCATGCAAATTTTCCATGACGCG
TATTTCGACGGAAAAATTGATTTCAACGGCGACGTTTTGGACATCATGGAGCAACGTCATGACTGGGCCAAGTTC
AACTTTACTATGGAGTTGTTCAAATACGTCTTCACAGTCCTCATTCCTTGCGTAATTTCCCACTCTCAAACGCAG
GACGAAGAACAAGTTCGTGACCACTATGACCGAGGTGATGACTTTTATGGTTGGTTCTTGGGTCCTCGCATGATC
TACACGTCGGGTATCATCATCAAGCCTGACGCTGAAGAATCTCTCGAGGAACTCCAGGACAACAAGCTTGCTGTC
GTTTGCAGCAAGCTTGATCTCCAACCTGAAGATCGTCTCCTCGACATTGGTTGTGGCTGGGGCACCCTCGTTGCT
TATGCCGCCAAGAATTATGAATGTGACGCAACTGGGGTTACGCTTGCTAAAAACCAGGCCAAGTTTGGGACAGAC
CGTATCGAGAAGAATGGTGTTCCCGCTTCTCGCGCCCGGATCCTTTGTTCTGACTACCGCGATATCCCTGCTGGC
ACTACGTATACGAAAATTGTTAGCTTGGAAATGGCAGAGCACGTTGGTGTTCGACGTTACTCTCAATTCTTGAGT
CAAGTCTATGACTTGCTCGACGATGATGGTCTCTTCGTCTTCCAAGTTGCTGGTATTCGTCCTTCATGGCAATAT
GAGGACCTTATTTGGGGTCTGTTCATGAACAAATATGTCTTCCCTGGTGCTGATGCATCTTGTTCTCTTGGTTGG
GTCATCAACAAGCTCGAGGGTGCCGGCTTTGAAGTCAAGAACATTGACGTCCTTGGTGTTCACTATTCTGCCACC
ATCTATCGCTGGTACCAGAACTGGGTTAGCAACAAGGAGGCTGTCATCCAGGCTTACGGCGAGAGGTGGTATAGG
ATCTGGGCGTTCTTCCTTGCGTACAGTGTCATCATCAGCCGACAGGGTGGTGCCTCGGTCTTCCAGATTACGCTT
CACAAAAACTTGAATGCCTTCCATCGCGTTCAGGGTGTCAAAAGTCATGCTTCCATCCACGTAAAGCTCGACAAG
GAGCCTGAACTTATTGAGTAA
Transcript >AgabiH97|031340
ATGTCGTCCTCTGTCCGTGTCACCGACTATCCTGCGATCAAGAACGCCCCCCTCGTCGGTCTCGCGGAGGGCAAT
GGCTCCTTCAACAACATCCACCTCGCCGGCCTCGTCCTCACCGTTCCTTACTTGCTCAAGTGGTTCCTTCCCTTA
TTTAACCGAGGCGGCTTCAAGACCTATCTCTTTCTCCTCGTCCTCTCCGGTGTCCCCACAACCGTCGCATACTGG
ACAGTTATGAGCCACATCGGTTCTCGCCGCAACGAAAAAGTCGCCCTTCCTGGCAAAGACATTGAAGAGTACATC
ACCATCAACGACGAAGACCTGAAGCGTACCTACAAGAGAAAAGACAAGATTCCCATGCAAATTTTCCATGACGCG
TATTTCGACGGAAAAATTGATTTCAACGGCGACGTTTTGGACATCATGGAGCAACGTCATGACTGGGCCAAGTTC
AACTTTACTATGGAGTTGTTCAAATACGTCTTCACAGTCCTCATTCCTTGCGTAATTTCCCACTCTCAAACGCAG
GACGAAGAACAAGTTCGTGACCACTATGACCGAGGTGATGACTTTTATGGTTGGTTCTTGGGTCCTCGCATGATC
TACACGTCGGGTATCATCATCAAGCCTGACGCTGAAGAATCTCTCGAGGAACTCCAGGACAACAAGCTTGCTGTC
GTTTGCAGCAAGCTTGATCTCCAACCTGAAGATCGTCTCCTCGACATTGGTTGTGGCTGGGGCACCCTCGTTGCT
TATGCCGCCAAGAATTATGAATGTGACGCAACTGGGGTTACGCTTGCTAAAAACCAGGCCAAGTTTGGGACAGAC
CGTATCGAGAAGAATGGTGTTCCCGCTTCTCGCGCCCGGATCCTTTGTTCTGACTACCGCGATATCCCTGCTGGC
ACTACGTATACGAAAATTGTTAGCTTGGAAATGGCAGAGCACGTTGGTGTTCGACGTTACTCTCAATTCTTGAGT
CAAGTCTATGACTTGCTCGACGATGATGGTCTCTTCGTCTTCCAAGTTGCTGGTATTCGTCCTTCATGGCAATAT
GAGGACCTTATTTGGGGTCTGTTCATGAACAAATATGTCTTCCCTGGTGCTGATGCATCTTGTTCTCTTGGTTGG
GTCATCAACAAGCTCGAGGGTGCCGGCTTTGAAGTCAAGAACATTGACGTCCTTGGTGTTCACTATTCTGCCACC
ATCTATCGCTGGTACCAGAACTGGGTTAGCAACAAGGAGGCTGTCATCCAGGCTTACGGCGAGAGGTGGTATAGG
ATCTGGGCGTTCTTCCTTGCGTACAGTGTCATCATCAGCCGACAGGGTGGTGCCTCGGTCTTCCAGATTACGCTT
CACAAAAACTTGAATGCCTTCCATCGCGTTCAGGGTGTCAAAAGTCATGCTTCCATCCACGTAAAGCTCGACAAG
GAGCCTGAACTTATTGAGTAA
Gene >AgabiH97|031340
ATGTCGTCCTCTGTCCGTGTCACCGACTATCCTGCGATCAAGAACGCCCCCCTCGTCGGTCTCGCGGAGGGCAAT
GGCTCCTTCAACAACATCCACCTCGCCGGCCTCGTCCTCACCGTTCCTTACTTGCTCAAGTGGTTCCTTCCCTTA
TTTAACCGAGGCGGCTTCAAGACCTATCTCTTTCTCCTCGTCCTCTCCGGTGTCCCCACAACCGTCGCATACTGG
ACAGTTATGAGCCACATCGGTTCTCGCCGCAACGAAAAAGTCGCCCTTCCTGGCAAAGACATTGAAGAGTACATC
ACCATCAACGACGAAGACCTGAAGCGTACCTACAAGAGAAAAGACAAGATTCCCATGCAAATTTTCCATGACGCG
TATTTCGACGGAAAAATTGATTTCAACGGTTAGCAGCGCGTCTACATGTCTTCTCTTCAGGTCACTGATGTGTGC
AACAGGCGACGTTTTGGACATCATGGAGCAACGTCATGACTGGGCCAAGTTCAACTTTACTATGGAGTTGTTCAA
ATACGTCTTCACAGTCCTCATTCCTTGCGTAATTTCCCACTCTCAAACGCAGGACGAAGAACAAGTTCGTGACCA
CTATGACCGTATGTCCCATGCACTCGCCTGTTCGGTCTCTTCATTGACGTCTATCGCAGGAGGTGATGACTTTTA
TGGTTGGTTCTTGGGTCCTCGCATGATCTACACGTCGGGTATCATCATCAAGCCTGACGCTGAAGAATCTCTCGA
GGAACTCCAGGACAACAAGCTTGCTGTCGTTTGCAGCAAGCTTGATCTCCAACCTGAAGATCGTCTCCTCGACAT
TGGTTGTGGCTGGGGCACCCTCGTTGCTTATGCCGCCAAGAATTATGAATGTGACGCAACTGGGGTTACGCTTGC
TAAAAACCAGGCCAAGTTTGGGACAGACCGTATCGAGAAGAATGGTGTACGTCTTTTGTTGAGTAGACCATGCGT
AGATACGCTGACTATGTTCCCTCAGGTTCCCGCTTCTCGCGCCCGGATCCTTTGTTCTGACTACCGCGATATCCC
TGCTGGCACTACGTATACGAAAATTGTTAGCTTGGAAATGGCAGAGGTATGTAATATGTCGTTTGGTTATTTTTA
GCATCTGACCCTGGTCGTTAGCACGTTGGTGTTCGACGTTACTCTCAATTCTTGAGTCAAGTCTATGACTTGCTC
GACGATGATGGTCTCTTCGTCTTCCAAGTTGCTGGTATTCGTCCTTCATGGCAATATGAGGACCTTATTTGGTAT
GCCATTCATTCGATCCTCCTTTTTACCATAATTGTTAATCACCGTCCAAGGGGTCTGTTCATGAACAAATATGTC
TTCCCTGGTGCTGATGCATCTTGTTCTCTTGGTTGGGTCATCAACAAGGTATGCTAGTTGCCCGTGTCCAATTGC
TCTTTGGTTGACGTATCGTGTAGCTCGAGGGTGCCGGCTTTGAAGTCAAGAACATTGACGTCCTTGGTGTTCACT
ATTCTGCCACCATCTATCGCTGGTACCAGAACTGGGTTAGCAACAAGGAGGCTGTCATCCAGGCTTACGGCGAGA
GGTGGTATAGGATCTGGGCGTTCTTCCTTGCGTACAGTGTCATCATCAGCCGACAGGGTGGTGCCTCGGTCTTCC
AGATTACGCTTCACAAAAACTTGAATGCCTTCCATCGCGTTCAGGGTGTCAAAAGTCATGCTTCCATCCACGTAA
AGCTCGACAAGGAGCCTGAGTAAGTCCAATTATGTCAGTCTATGCTGGCCCTCTCTCAACAACCTCTTTTGTTCG
ACAGACTTATTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail