Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|030830
Gene name
Locationscaffold_12:745714..749980
Strand-
Gene length (bp)4266
Transcript length (bp)4266
Coding sequence length (bp)4266
Protein length (aa) 1422

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 6.2E-64 936 1179
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.2E-11 62 204
PF13976 gag_pre-integrs GAG-pre-integrase domain 3.6E-10 431 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 9 1420 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 219 1413 6.0E-148
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1017 1328 2.0E-47
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 918 1413 4.0E-36
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 922 1413 8.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 9 1420 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 219 1413 6.0E-148
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1017 1328 2.0E-47
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 918 1413 4.0E-36
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 922 1413 8.0E-36
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 918 1413 9.0E-36
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 918 1413 9.0E-36
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 918 1413 1.0E-35
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 918 1413 1.0E-35
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 922 1413 1.0E-35
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 922 1413 1.0E-35
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 918 1413 1.0E-35
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 922 1413 2.0E-35
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 918 1413 2.0E-35
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 918 1413 2.0E-35
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 922 1413 2.0E-35
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 918 1413 2.0E-35
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 922 1413 2.0E-35
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 918 1413 3.0E-35
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 922 1413 3.0E-35
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 922 1413 4.0E-35
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 922 1413 4.0E-35
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 922 1413 4.0E-35
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 922 1413 5.0E-35
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 922 1413 5.0E-35
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 918 1413 5.0E-35
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 922 1413 1.0E-34
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 922 1413 4.0E-34
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 922 1413 4.0E-34
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 922 1413 6.0E-34
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 922 1413 6.0E-34
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 922 1413 7.0E-34
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 922 1413 8.0E-34
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 922 1413 3.0E-33
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 922 1413 3.0E-33
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 922 1413 3.0E-33
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 922 1413 5.0E-33
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 922 1413 1.0E-32
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 922 1413 3.0E-32
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 922 1413 3.0E-32
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1101 1331 3.0E-32
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 922 1413 3.0E-32
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 922 1413 4.0E-32
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 922 1413 6.0E-32
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 922 1413 1.0E-31
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 922 1413 1.0E-31
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 922 1413 2.0E-31
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 946 1356 2.0E-26
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 946 1356 2.0E-26
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 922 1230 3.0E-23
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 918 1182 8.0E-22
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 244 657 6.0E-18
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 237 657 7.0E-18
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 244 657 8.0E-18
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 244 657 8.0E-18
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 244 657 9.0E-18
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 244 657 9.0E-18
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 315 657 1.0E-17
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 244 657 1.0E-17
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 315 657 1.0E-17
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 315 657 1.0E-17
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 315 657 1.0E-17
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 315 657 1.0E-17
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 315 657 1.0E-17
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 315 657 1.0E-17
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 315 657 1.0E-17
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 244 657 1.0E-17
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 315 657 1.0E-17
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 244 657 1.0E-17
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 244 657 1.0E-17
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 244 657 1.0E-17
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 315 657 1.0E-17
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 244 657 1.0E-17
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 244 657 1.0E-17
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 244 657 1.0E-17
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 244 657 1.0E-17
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 244 657 1.0E-17
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 315 657 1.0E-17
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 244 657 2.0E-17
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 244 657 2.0E-17
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 244 657 2.0E-17
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 244 657 2.0E-17
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 244 657 2.0E-17
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 244 657 2.0E-17
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 244 657 2.0E-17
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 251 657 2.0E-17
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 244 657 2.0E-17
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 244 657 2.0E-17
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 244 657 2.0E-17
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 315 657 3.0E-17
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 244 657 3.0E-17
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 244 657 3.0E-17
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 237 657 4.0E-17
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 315 657 1.0E-16
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 244 657 3.0E-16
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 906 1009 9.0E-16
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 484 657 4.0E-14
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 317 733 1.0E-09
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 317 733 1.0E-09
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 317 733 2.0E-09
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 622 706 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|030830
MASGSPTFAKLNEENYSTWSGEMEAWLRASGLWRLVSGRQKAPSTSSPVTQAEADALDAFEARLDKAAGWLYLMV
EQEQRIHFSGIQDSPVKMWEALEAVHRQKRAGMRFNAYDELFSIRKLEEESLQSLINRVESSKRKIKELRPSSFT
LEMLDDELASMALIRALPDEFSAFTSSLLLMDKLDKSTIHQAFVTEDLQRKKRAQDASTSSHALAARSGSQNTPK
TCDFCGREGHKFAECKTFERAKSRAQEDAQKPRTPYKRANKAQEESGSSSSTQAPEKVQRVSEFAGNASTPYPSP
SPSPSTPLQLDADFHWLADTGATSHMTPHRHWFKSYTSHKIPIRLADNSIVYSSGVGSVVFEPVVNGKVVRAVEL
TRVLHVPALRSNLLSCLYLARNKGFNITISSHSIDFKHKGTSLFTATIHSNNSAELDGSTVTSETAFSVSTLPVD
LSLWHRRFIHHNYADVKSMISKDLVSGLKLESNSSPDSICEPCLAGKMHSLPFPSSLNHNRSPLELVHSDLHGPL
PVASHSGYKYWITFIDDATRFRAVYLLKAKSEAFEAFKVYKSWAETQLGVKLRALQDDKGGEYMSNAFKSFTELA
GIERRHSTRNRPQQNGLAERANRTMGERITAMLSESRLPGSFWGECISSMVHVWNMLPTASLSGTTPFQAFYKRK
PDVSHLRVWGCTSYVHVQRDKRNSLQPHYEKCVFIGYPAGYKGWKFYNPVTKRTVISERADFDERYFPGTSKAQL
EAVPSFACLPEPLQTPNDTSSYSGLPPLQDEGGDNHIPPACPKTPTPSASVPPEEKPVLPLPLPVIPPFIPPVIP
PVTPPQIHAPLPVTPPTAGVPLEPPHVPRRTGRVRKPPGQWWKLKQPDLAGNDSDSDDEAALLADSEYCEVEFAG
AVSGADPRSYRLAMKSPDSDCWTDACNTEIFNLEANGTWELMELPPGKKVVNSGWVFKVKRLADGSIERYRARLV
AKGYSQRPGFDFTEVFAPTFRPASLRLIVALAAREGYKMRSVDISSAFTYGELEEEIYMRQPEGYHIGSPNMVFR
LRKSLYGLKQAARQWNKKLRGVLEGIGYTRLRSDSSIYIYSKGDIKVIVPVFIDDITLVSKSDAAMASAVTELSK
HFKLRDLGSTTLLLGIQVKQDHSHHTISLSQEHYIKELLERFNMDDANPLSTPLAPGSELSDIIPSLEDQAEMKS
VPYLNAVGALQYLATMTRPDIAYAVSYLGRFNSNPAPAHWLAVKHLFRYLIGTMHYKLVYRASDSEELFTTYSDA
SHGACKATGRATGGYVTLVSGAAVGWSSKRQPFVTLSSTEAEFVAAVEAGKEIKWTRNILTEFGFPLTLPSTLFV
DNKSGISVAKNPEHHGRMKHLDLRFYWLREAVEEGLIDPLYVSTHEQVADILTKAVAKKVVEFAVPLLGLE*
Coding >AgabiH97|030830
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAAGGATTCACTTCTCTGGCATCCAGGACAGCCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCTCTATCCGAAAACTCGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAGCCTCTATGGCTCTCATTAGAGCTCTCCCTGACGAGTTTTCCGCCTTCACC
TCGTCTCTATTGCTTATGGACAAGCTAGACAAGTCCACCATTCATCAGGCCTTTGTTACTGAGGATTTGCAACGC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTCGCTCTGGCTCTCAAAACACGCCGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTGCTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCTGGGAGCTCTAGC
TCGACTCAGGCTCCCGAAAAAGTGCAACGGGTGTCCGAGTTTGCTGGCAATGCAAGTACTCCTTATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACTAGTCACAAAATCCCTATCCGACTAGCAGACAACTCTATT
GTCTATTCTTCGGGAGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTCGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTACTATCATGTTTATACCTTGCCCGTAACAAGGGCTTC
AATATCACAATCTCCTCTCACTCCATTGACTTCAAACATAAGGGCACATCGCTTTTCACGGCCACTATCCATTCC
AACAACTCTGCTGAGCTCGACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCGGTTGAC
CTCTCGCTATGGCATCGTCGCTTCATTCATCACAACTACGCTGATGTGAAGTCTATGATCAGTAAGGACCTTGTT
TCCGGGCTCAAACTCGAGTCTAACTCGTCCCCTGACTCTATCTGTGAGCCGTGTCTAGCTGGCAAGATGCATTCT
CTCCCTTTTCCCTCCTCCTTGAATCACAATCGCTCTCCTCTTGAGCTGGTGCATTCAGATCTTCACGGACCGCTC
CCAGTCGCTTCACACTCAGGCTACAAGTACTGGATCACCTTTATTGACGACGCGACGCGTTTCCGGGCAGTCTAT
CTGCTTAAAGCTAAGTCGGAGGCATTTGAAGCCTTCAAAGTCTACAAATCCTGGGCTGAGACTCAACTCGGAGTC
AAACTGCGAGCACTACAGGATGACAAGGGAGGTGAATACATGTCTAATGCTTTCAAAAGCTTTACTGAGCTTGCT
GGCATCGAGAGACGTCACTCGACTCGAAACCGGCCACAGCAGAATGGTCTTGCTGAACGGGCTAATAGGACTATG
GGAGAGAGGATCACTGCTATGCTCTCGGAATCTCGGCTGCCTGGGTCTTTCTGGGGTGAATGTATCTCGTCTATG
GTCCATGTCTGGAATATGCTCCCTACTGCTTCGCTTTCGGGCACTACTCCCTTCCAAGCTTTCTATAAGCGAAAA
CCTGATGTCTCACATCTCCGGGTCTGGGGGTGCACTTCCTATGTCCATGTACAACGAGATAAGCGCAATTCTCTC
CAACCTCACTACGAGAAGTGTGTCTTTATTGGCTATCCGGCTGGCTACAAAGGCTGGAAGTTCTACAACCCAGTC
ACTAAGCGAACCGTGATCTCTGAGAGAGCTGATTTTGATGAGAGATACTTTCCGGGCACTTCTAAAGCCCAACTC
GAGGCTGTCCCGTCATTTGCTTGCCTACCAGAGCCACTACAAACTCCTAATGATACATCATCATACTCAGGACTG
CCACCTCTACAGGATGAAGGGGGTGATAATCACATCCCTCCTGCTTGTCCTAAGACTCCCACTCCGTCCGCTTCA
GTTCCTCCTGAAGAGAAGCCAGTTCTACCCCTACCACTTCCAGTAATTCCCCCATTCATTCCTCCTGTGATTCCT
CCAGTCACTCCTCCCCAAATCCATGCACCACTCCCAGTTACTCCTCCTACTGCCGGAGTGCCTCTTGAGCCCCCT
CACGTTCCTAGACGTACTGGGCGAGTTCGGAAGCCTCCTGGTCAGTGGTGGAAGCTCAAACAACCAGACTTAGCT
GGTAATGACTCTGACTCTGACGACGAAGCTGCTCTGCTAGCTGACTCGGAGTACTGTGAAGTCGAGTTTGCTGGA
GCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGATGCT
TGTAACACTGAGATATTCAATCTCGAGGCTAACGGGACTTGGGAGCTCATGGAACTGCCTCCAGGCAAGAAGGTA
GTCAACTCTGGCTGGGTCTTTAAAGTCAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGTCTCGTT
GCTAAAGGCTATTCCCAACGTCCCGGATTTGACTTCACCGAGGTCTTTGCCCCTACATTCCGTCCTGCATCACTA
CGCCTCATTGTTGCTCTAGCTGCTAGAGAAGGCTACAAAATGCGCTCAGTCGACATCTCTTCTGCCTTCACTTAT
GGGGAACTCGAAGAGGAGATCTATATGCGCCAACCCGAGGGCTATCACATTGGTAGTCCTAACATGGTCTTTCGG
CTCCGTAAATCGCTCTATGGCCTCAAGCAGGCTGCCAGGCAGTGGAATAAGAAACTCCGGGGTGTCCTTGAAGGC
ATTGGCTACACTAGGCTTCGCTCTGACAGCTCCATCTACATCTACTCCAAAGGTGACATCAAGGTCATTGTGCCA
GTATTCATTGACGACATTACTCTTGTCTCGAAAAGTGATGCTGCCATGGCCTCGGCTGTCACTGAGCTCTCGAAA
CACTTCAAGCTCCGTGATCTCGGGTCCACTACACTTCTGCTGGGTATTCAGGTGAAGCAGGATCACTCTCATCAC
ACTATCTCCCTCTCGCAGGAGCACTACATCAAGGAGCTCCTAGAACGCTTCAATATGGATGATGCTAATCCACTT
TCCACTCCACTCGCTCCGGGATCTGAACTCTCTGACATTATTCCTTCACTCGAGGATCAGGCTGAGATGAAGTCA
GTTCCCTATCTCAATGCTGTAGGTGCCCTTCAGTATCTCGCCACTATGACTCGTCCCGACATCGCCTATGCTGTC
TCCTATCTCGGGAGGTTCAACTCGAACCCAGCTCCGGCTCACTGGCTTGCAGTCAAGCACTTATTCCGGTATCTC
ATTGGCACTATGCACTACAAGCTAGTCTATCGAGCTAGTGACTCGGAGGAACTCTTCACTACCTACTCGGACGCC
TCTCACGGAGCCTGCAAGGCTACAGGTCGAGCAACTGGTGGTTATGTGACTCTTGTCTCGGGAGCTGCTGTGGGC
TGGTCTTCTAAGCGCCAGCCATTTGTGACTCTCTCGAGCACTGAGGCTGAGTTTGTTGCTGCCGTCGAGGCTGGC
AAGGAGATCAAGTGGACTAGGAATATCCTGACCGAGTTTGGCTTCCCTCTGACACTTCCTTCGACACTCTTTGTT
GATAACAAGTCAGGAATCAGTGTAGCCAAGAATCCAGAGCATCACGGACGCATGAAACACCTAGACCTGCGCTTC
TACTGGCTCCGGGAGGCTGTTGAAGAAGGACTCATAGATCCTTTGTATGTTTCTACACACGAGCAAGTGGCCGAC
ATCCTTACCAAGGCTGTGGCAAAGAAGGTAGTTGAGTTTGCTGTCCCTCTATTAGGACTTGAGTAG
Transcript >AgabiH97|030830
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAAGGATTCACTTCTCTGGCATCCAGGACAGCCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCTCTATCCGAAAACTCGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAGCCTCTATGGCTCTCATTAGAGCTCTCCCTGACGAGTTTTCCGCCTTCACC
TCGTCTCTATTGCTTATGGACAAGCTAGACAAGTCCACCATTCATCAGGCCTTTGTTACTGAGGATTTGCAACGC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTCGCTCTGGCTCTCAAAACACGCCGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTGCTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCTGGGAGCTCTAGC
TCGACTCAGGCTCCCGAAAAAGTGCAACGGGTGTCCGAGTTTGCTGGCAATGCAAGTACTCCTTATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACTAGTCACAAAATCCCTATCCGACTAGCAGACAACTCTATT
GTCTATTCTTCGGGAGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTCGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTACTATCATGTTTATACCTTGCCCGTAACAAGGGCTTC
AATATCACAATCTCCTCTCACTCCATTGACTTCAAACATAAGGGCACATCGCTTTTCACGGCCACTATCCATTCC
AACAACTCTGCTGAGCTCGACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCGGTTGAC
CTCTCGCTATGGCATCGTCGCTTCATTCATCACAACTACGCTGATGTGAAGTCTATGATCAGTAAGGACCTTGTT
TCCGGGCTCAAACTCGAGTCTAACTCGTCCCCTGACTCTATCTGTGAGCCGTGTCTAGCTGGCAAGATGCATTCT
CTCCCTTTTCCCTCCTCCTTGAATCACAATCGCTCTCCTCTTGAGCTGGTGCATTCAGATCTTCACGGACCGCTC
CCAGTCGCTTCACACTCAGGCTACAAGTACTGGATCACCTTTATTGACGACGCGACGCGTTTCCGGGCAGTCTAT
CTGCTTAAAGCTAAGTCGGAGGCATTTGAAGCCTTCAAAGTCTACAAATCCTGGGCTGAGACTCAACTCGGAGTC
AAACTGCGAGCACTACAGGATGACAAGGGAGGTGAATACATGTCTAATGCTTTCAAAAGCTTTACTGAGCTTGCT
GGCATCGAGAGACGTCACTCGACTCGAAACCGGCCACAGCAGAATGGTCTTGCTGAACGGGCTAATAGGACTATG
GGAGAGAGGATCACTGCTATGCTCTCGGAATCTCGGCTGCCTGGGTCTTTCTGGGGTGAATGTATCTCGTCTATG
GTCCATGTCTGGAATATGCTCCCTACTGCTTCGCTTTCGGGCACTACTCCCTTCCAAGCTTTCTATAAGCGAAAA
CCTGATGTCTCACATCTCCGGGTCTGGGGGTGCACTTCCTATGTCCATGTACAACGAGATAAGCGCAATTCTCTC
CAACCTCACTACGAGAAGTGTGTCTTTATTGGCTATCCGGCTGGCTACAAAGGCTGGAAGTTCTACAACCCAGTC
ACTAAGCGAACCGTGATCTCTGAGAGAGCTGATTTTGATGAGAGATACTTTCCGGGCACTTCTAAAGCCCAACTC
GAGGCTGTCCCGTCATTTGCTTGCCTACCAGAGCCACTACAAACTCCTAATGATACATCATCATACTCAGGACTG
CCACCTCTACAGGATGAAGGGGGTGATAATCACATCCCTCCTGCTTGTCCTAAGACTCCCACTCCGTCCGCTTCA
GTTCCTCCTGAAGAGAAGCCAGTTCTACCCCTACCACTTCCAGTAATTCCCCCATTCATTCCTCCTGTGATTCCT
CCAGTCACTCCTCCCCAAATCCATGCACCACTCCCAGTTACTCCTCCTACTGCCGGAGTGCCTCTTGAGCCCCCT
CACGTTCCTAGACGTACTGGGCGAGTTCGGAAGCCTCCTGGTCAGTGGTGGAAGCTCAAACAACCAGACTTAGCT
GGTAATGACTCTGACTCTGACGACGAAGCTGCTCTGCTAGCTGACTCGGAGTACTGTGAAGTCGAGTTTGCTGGA
GCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGATGCT
TGTAACACTGAGATATTCAATCTCGAGGCTAACGGGACTTGGGAGCTCATGGAACTGCCTCCAGGCAAGAAGGTA
GTCAACTCTGGCTGGGTCTTTAAAGTCAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGTCTCGTT
GCTAAAGGCTATTCCCAACGTCCCGGATTTGACTTCACCGAGGTCTTTGCCCCTACATTCCGTCCTGCATCACTA
CGCCTCATTGTTGCTCTAGCTGCTAGAGAAGGCTACAAAATGCGCTCAGTCGACATCTCTTCTGCCTTCACTTAT
GGGGAACTCGAAGAGGAGATCTATATGCGCCAACCCGAGGGCTATCACATTGGTAGTCCTAACATGGTCTTTCGG
CTCCGTAAATCGCTCTATGGCCTCAAGCAGGCTGCCAGGCAGTGGAATAAGAAACTCCGGGGTGTCCTTGAAGGC
ATTGGCTACACTAGGCTTCGCTCTGACAGCTCCATCTACATCTACTCCAAAGGTGACATCAAGGTCATTGTGCCA
GTATTCATTGACGACATTACTCTTGTCTCGAAAAGTGATGCTGCCATGGCCTCGGCTGTCACTGAGCTCTCGAAA
CACTTCAAGCTCCGTGATCTCGGGTCCACTACACTTCTGCTGGGTATTCAGGTGAAGCAGGATCACTCTCATCAC
ACTATCTCCCTCTCGCAGGAGCACTACATCAAGGAGCTCCTAGAACGCTTCAATATGGATGATGCTAATCCACTT
TCCACTCCACTCGCTCCGGGATCTGAACTCTCTGACATTATTCCTTCACTCGAGGATCAGGCTGAGATGAAGTCA
GTTCCCTATCTCAATGCTGTAGGTGCCCTTCAGTATCTCGCCACTATGACTCGTCCCGACATCGCCTATGCTGTC
TCCTATCTCGGGAGGTTCAACTCGAACCCAGCTCCGGCTCACTGGCTTGCAGTCAAGCACTTATTCCGGTATCTC
ATTGGCACTATGCACTACAAGCTAGTCTATCGAGCTAGTGACTCGGAGGAACTCTTCACTACCTACTCGGACGCC
TCTCACGGAGCCTGCAAGGCTACAGGTCGAGCAACTGGTGGTTATGTGACTCTTGTCTCGGGAGCTGCTGTGGGC
TGGTCTTCTAAGCGCCAGCCATTTGTGACTCTCTCGAGCACTGAGGCTGAGTTTGTTGCTGCCGTCGAGGCTGGC
AAGGAGATCAAGTGGACTAGGAATATCCTGACCGAGTTTGGCTTCCCTCTGACACTTCCTTCGACACTCTTTGTT
GATAACAAGTCAGGAATCAGTGTAGCCAAGAATCCAGAGCATCACGGACGCATGAAACACCTAGACCTGCGCTTC
TACTGGCTCCGGGAGGCTGTTGAAGAAGGACTCATAGATCCTTTGTATGTTTCTACACACGAGCAAGTGGCCGAC
ATCCTTACCAAGGCTGTGGCAAAGAAGGTAGTTGAGTTTGCTGTCCCTCTATTAGGACTTGAGTAG
Gene >AgabiH97|030830
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAAGGATTCACTTCTCTGGCATCCAGGACAGCCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCTCTATCCGAAAACTCGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAGCCTCTATGGCTCTCATTAGAGCTCTCCCTGACGAGTTTTCCGCCTTCACC
TCGTCTCTATTGCTTATGGACAAGCTAGACAAGTCCACCATTCATCAGGCCTTTGTTACTGAGGATTTGCAACGC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTCGCTCTGGCTCTCAAAACACGCCGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTGCTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCTGGGAGCTCTAGC
TCGACTCAGGCTCCCGAAAAAGTGCAACGGGTGTCCGAGTTTGCTGGCAATGCAAGTACTCCTTATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACTAGTCACAAAATCCCTATCCGACTAGCAGACAACTCTATT
GTCTATTCTTCGGGAGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTCGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTACTATCATGTTTATACCTTGCCCGTAACAAGGGCTTC
AATATCACAATCTCCTCTCACTCCATTGACTTCAAACATAAGGGCACATCGCTTTTCACGGCCACTATCCATTCC
AACAACTCTGCTGAGCTCGACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCGGTTGAC
CTCTCGCTATGGCATCGTCGCTTCATTCATCACAACTACGCTGATGTGAAGTCTATGATCAGTAAGGACCTTGTT
TCCGGGCTCAAACTCGAGTCTAACTCGTCCCCTGACTCTATCTGTGAGCCGTGTCTAGCTGGCAAGATGCATTCT
CTCCCTTTTCCCTCCTCCTTGAATCACAATCGCTCTCCTCTTGAGCTGGTGCATTCAGATCTTCACGGACCGCTC
CCAGTCGCTTCACACTCAGGCTACAAGTACTGGATCACCTTTATTGACGACGCGACGCGTTTCCGGGCAGTCTAT
CTGCTTAAAGCTAAGTCGGAGGCATTTGAAGCCTTCAAAGTCTACAAATCCTGGGCTGAGACTCAACTCGGAGTC
AAACTGCGAGCACTACAGGATGACAAGGGAGGTGAATACATGTCTAATGCTTTCAAAAGCTTTACTGAGCTTGCT
GGCATCGAGAGACGTCACTCGACTCGAAACCGGCCACAGCAGAATGGTCTTGCTGAACGGGCTAATAGGACTATG
GGAGAGAGGATCACTGCTATGCTCTCGGAATCTCGGCTGCCTGGGTCTTTCTGGGGTGAATGTATCTCGTCTATG
GTCCATGTCTGGAATATGCTCCCTACTGCTTCGCTTTCGGGCACTACTCCCTTCCAAGCTTTCTATAAGCGAAAA
CCTGATGTCTCACATCTCCGGGTCTGGGGGTGCACTTCCTATGTCCATGTACAACGAGATAAGCGCAATTCTCTC
CAACCTCACTACGAGAAGTGTGTCTTTATTGGCTATCCGGCTGGCTACAAAGGCTGGAAGTTCTACAACCCAGTC
ACTAAGCGAACCGTGATCTCTGAGAGAGCTGATTTTGATGAGAGATACTTTCCGGGCACTTCTAAAGCCCAACTC
GAGGCTGTCCCGTCATTTGCTTGCCTACCAGAGCCACTACAAACTCCTAATGATACATCATCATACTCAGGACTG
CCACCTCTACAGGATGAAGGGGGTGATAATCACATCCCTCCTGCTTGTCCTAAGACTCCCACTCCGTCCGCTTCA
GTTCCTCCTGAAGAGAAGCCAGTTCTACCCCTACCACTTCCAGTAATTCCCCCATTCATTCCTCCTGTGATTCCT
CCAGTCACTCCTCCCCAAATCCATGCACCACTCCCAGTTACTCCTCCTACTGCCGGAGTGCCTCTTGAGCCCCCT
CACGTTCCTAGACGTACTGGGCGAGTTCGGAAGCCTCCTGGTCAGTGGTGGAAGCTCAAACAACCAGACTTAGCT
GGTAATGACTCTGACTCTGACGACGAAGCTGCTCTGCTAGCTGACTCGGAGTACTGTGAAGTCGAGTTTGCTGGA
GCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGATGCT
TGTAACACTGAGATATTCAATCTCGAGGCTAACGGGACTTGGGAGCTCATGGAACTGCCTCCAGGCAAGAAGGTA
GTCAACTCTGGCTGGGTCTTTAAAGTCAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGTCTCGTT
GCTAAAGGCTATTCCCAACGTCCCGGATTTGACTTCACCGAGGTCTTTGCCCCTACATTCCGTCCTGCATCACTA
CGCCTCATTGTTGCTCTAGCTGCTAGAGAAGGCTACAAAATGCGCTCAGTCGACATCTCTTCTGCCTTCACTTAT
GGGGAACTCGAAGAGGAGATCTATATGCGCCAACCCGAGGGCTATCACATTGGTAGTCCTAACATGGTCTTTCGG
CTCCGTAAATCGCTCTATGGCCTCAAGCAGGCTGCCAGGCAGTGGAATAAGAAACTCCGGGGTGTCCTTGAAGGC
ATTGGCTACACTAGGCTTCGCTCTGACAGCTCCATCTACATCTACTCCAAAGGTGACATCAAGGTCATTGTGCCA
GTATTCATTGACGACATTACTCTTGTCTCGAAAAGTGATGCTGCCATGGCCTCGGCTGTCACTGAGCTCTCGAAA
CACTTCAAGCTCCGTGATCTCGGGTCCACTACACTTCTGCTGGGTATTCAGGTGAAGCAGGATCACTCTCATCAC
ACTATCTCCCTCTCGCAGGAGCACTACATCAAGGAGCTCCTAGAACGCTTCAATATGGATGATGCTAATCCACTT
TCCACTCCACTCGCTCCGGGATCTGAACTCTCTGACATTATTCCTTCACTCGAGGATCAGGCTGAGATGAAGTCA
GTTCCCTATCTCAATGCTGTAGGTGCCCTTCAGTATCTCGCCACTATGACTCGTCCCGACATCGCCTATGCTGTC
TCCTATCTCGGGAGGTTCAACTCGAACCCAGCTCCGGCTCACTGGCTTGCAGTCAAGCACTTATTCCGGTATCTC
ATTGGCACTATGCACTACAAGCTAGTCTATCGAGCTAGTGACTCGGAGGAACTCTTCACTACCTACTCGGACGCC
TCTCACGGAGCCTGCAAGGCTACAGGTCGAGCAACTGGTGGTTATGTGACTCTTGTCTCGGGAGCTGCTGTGGGC
TGGTCTTCTAAGCGCCAGCCATTTGTGACTCTCTCGAGCACTGAGGCTGAGTTTGTTGCTGCCGTCGAGGCTGGC
AAGGAGATCAAGTGGACTAGGAATATCCTGACCGAGTTTGGCTTCCCTCTGACACTTCCTTCGACACTCTTTGTT
GATAACAAGTCAGGAATCAGTGTAGCCAAGAATCCAGAGCATCACGGACGCATGAAACACCTAGACCTGCGCTTC
TACTGGCTCCGGGAGGCTGTTGAAGAAGGACTCATAGATCCTTTGTATGTTTCTACACACGAGCAAGTGGCCGAC
ATCCTTACCAAGGCTGTGGCAAAGAAGGTAGTTGAGTTTGCTGTCCCTCTATTAGGACTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail