Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|030810
Gene name
Locationscaffold_12:735813..740028
Strand+
Gene length (bp)4215
Transcript length (bp)4215
Coding sequence length (bp)4215
Protein length (aa) 1405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 4.1E-45 917 1155
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.1E-13 93 219
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.5E-12 459 529

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 1395 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 852 1401 2.0E-92
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 171 775 9.0E-45
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1080 1310 3.0E-30
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 996 1307 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 1395 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 852 1401 2.0E-92
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 171 775 9.0E-45
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1080 1310 3.0E-30
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 996 1307 2.0E-27
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 299 720 1.0E-25
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 299 720 2.0E-25
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 299 720 2.0E-25
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 299 720 3.0E-25
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 299 720 3.0E-25
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 299 720 3.0E-25
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 299 720 3.0E-25
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 299 720 4.0E-25
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 299 720 4.0E-25
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 299 720 4.0E-25
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 299 720 4.0E-25
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 299 720 4.0E-25
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 299 720 4.0E-25
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 299 720 4.0E-25
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 299 720 4.0E-25
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 299 720 4.0E-25
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 299 720 4.0E-25
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 299 720 4.0E-25
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 299 720 4.0E-25
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 299 720 5.0E-25
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 299 720 5.0E-25
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 299 720 5.0E-25
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 299 720 6.0E-25
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 299 720 6.0E-25
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 299 720 6.0E-25
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 348 720 6.0E-25
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 299 720 7.0E-25
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 299 720 1.0E-24
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 348 720 1.0E-24
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 348 720 1.0E-24
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 348 720 2.0E-24
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 348 690 3.0E-24
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 348 690 3.0E-24
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 348 690 3.0E-24
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 348 690 3.0E-24
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 348 690 3.0E-24
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 348 690 3.0E-24
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 348 690 3.0E-24
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 299 720 3.0E-24
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 348 690 3.0E-24
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 348 690 3.0E-24
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 348 690 3.0E-24
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 348 690 3.0E-24
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 348 690 4.0E-24
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 479 793 5.0E-17
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 479 782 1.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 479 782 2.0E-16
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 523 720 8.0E-16
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 927 1387 2.0E-13
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 927 1387 5.0E-13
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 927 1387 6.0E-13
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 927 1387 6.0E-13
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 927 1387 6.0E-13
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 927 1387 6.0E-13
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 927 1387 6.0E-13
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 927 1387 7.0E-13
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 927 1387 7.0E-13
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 927 1387 8.0E-13
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 927 1387 9.0E-13
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 927 1387 1.0E-12
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 927 1387 1.0E-12
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 927 1387 1.0E-12
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 852 1384 1.0E-12
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 927 1387 2.0E-12
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 927 1387 2.0E-12
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 927 1387 2.0E-12
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 927 1387 2.0E-12
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 927 1387 2.0E-12
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 927 1387 2.0E-12
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 927 1387 2.0E-12
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 927 1387 3.0E-12
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 927 1387 4.0E-12
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 852 1384 4.0E-12
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 927 1387 5.0E-12
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 927 1387 5.0E-12
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 927 1387 7.0E-12
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 927 1387 1.0E-11
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 927 1387 1.0E-11
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 927 1387 1.0E-11
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 927 1387 1.0E-11
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 927 1387 2.0E-11
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 927 1387 2.0E-11
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 927 1387 2.0E-11
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 888 986 2.0E-11
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 927 1387 3.0E-11
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 927 1387 3.0E-11
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 927 1387 4.0E-11
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 927 1387 1.0E-10
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 927 1387 1.0E-10
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 927 1387 1.0E-10
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 927 1387 1.0E-10
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 927 1387 1.0E-10
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 927 1387 2.0E-10
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 927 1387 2.0E-10
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1192 1274 5.0E-10
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 658 742 5.0E-08
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 517 686 2.0E-06
sp|P93293|M300_ARATH Uncharacterized mitochondrial protein AtMg00300 OS=Arabidopsis thaliana GN=AtMg00300 PE=4 SV=1 450 560 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|030810
MSGMGGNTPPMFADTAKFNGNNWVSWNNLIRIAAELRGVSGYLDGSIINPTSNPLNVPLPSSPPDTTTSQTTSPT
STPTETSWESTTPSTAEWKVRNAWAKGLLIYNTDDPVGLGINIHGSAAEAWKSYVDTYEVASEVALLNAELELHN
MLYADDQDFVQYISKLRTKWSNATALGAKIDDKAFRTIILNSLPRSWDSIVATLYTTQSSHEAINQLMAHWARIS
RNRSQNSQSTTTALQTSSDVCRDRPRGQNQQLQCTNQNCGRRGHTIENCYWPGGGKAGQFPPGFGKRGGVRGLTN
NAASTGQTSANTASSDNGNGNNKPTVFALATITPEDVDSASTREIITLLDSGASDHCIVQRDYFVQYKPISPPRL
GNSASEESTFNIDGSGTAVLWVHRKESTSKILLGDALHTPQLRSNLISVSKLVAKGFKVSFEGGSAVVRSASGET
VLEAAKANGLYVIPVGTNTPSANVVQARRKAVPFDIWHRRFGHVGVDVLKRMARDKLVDGLNIEGTTEMMGMCED
CIYGEHATHPFNNQAIAETEPLQCVYIDIWGPSPVQSAGGAKYFMLIMDGATSYRKVYFISNKSAEATLDVFKEF
HREAERQTGKRLKRVRLDMGREWHNRLQDEYVKSYGIVLDFSTPYAHQQNGKAERSMRTLLDMARTLLSDSGLPQ
KYWADSVQTAVYLRNFIPFTRQPDHIPAERWLGHRQDVSHLRPFGSTCYAHVPVEASPSKLSPHSVKLTLIGFFD
HTGYKLLVRSTGKAFRSRDVIFEESKPHYSTDPLITYPSDNDNATRPSDTFVAPQPKHITLLHPPAISTPSTTPV
TTPAVPISTAEGDSDVTPVVDSSATVRRSQRNRKPSQKMLDSMEYLGRPMAGVATIHDDLIVPKSYCDAMKRADL
WVPPMLKELTMMKEKGVFKLVPRPVGKNVVKSRWVFANKYNEAGEAIDRKARLVAKGFTQVLGEDYDETYASVAR
LESVRLVCTVAAARRMRLWQLDFISAFLNSDNVFEIYMEQPQGFEEGGDNVWLLLKTLYGTMQGAHDWAFNLNRT
YEGHGYYVSRADSQIRSKVEDTEFTLTSTWTDDVLGASSTELGEKKAKEELGNSYEVKDLGAAKFILGMKIERDE
KDGTIRLSQRSYCERILDRFNMGDATPKSTLLPPGIDLSTADSVPRSEDEMTEMEGVPYREALGSLMWLQVATRP
DLSFAVNLLSRFANNPGRTQWNAMKHALAYVKGTLDYGITYYPDSTLQPYGYVDTDFAGDCDSRRSTEGHIFFVA
GGPVSWASKHQETVALSTVEAEYMAFTCAVQQAVWLDKFLYEIDLAQQRPFTIYADNNGAIANTTNDRNHRRTKH
IDIKHHFIKEKVADNSVVFSYIPSSENLADILTKALPRDAVLRICFHFGLIAQS*
Coding >AgabiH97|030810
ATGTCCGGTATGGGTGGAAACACACCTCCCATGTTCGCCGACACGGCGAAATTCAATGGAAATAACTGGGTCTCT
TGGAACAACCTCATCCGTATAGCTGCTGAGCTTCGTGGTGTTTCTGGATACTTGGACGGTTCAATCATTAATCCT
ACAAGCAATCCGTTGAATGTGCCCTTACCTTCCTCACCGCCTGACACTACTACTTCACAGACCACATCTCCAACT
TCTACGCCGACAGAAACCTCATGGGAGTCTACAACTCCAAGCACTGCTGAATGGAAAGTGCGTAACGCATGGGCA
AAGGGCTTACTCATCTACAATACCGACGACCCAGTTGGCCTCGGCATAAACATACATGGTAGTGCCGCCGAAGCC
TGGAAATCATATGTGGACACATACGAAGTAGCGTCAGAAGTCGCGCTACTAAACGCCGAGTTGGAATTACACAAT
ATGCTCTATGCTGATGATCAGGACTTTGTTCAATATATCTCTAAACTTCGTACCAAGTGGTCTAATGCAACGGCT
TTGGGAGCGAAGATTGACGATAAAGCTTTCCGCACCATCATACTCAACTCACTTCCCCGTTCTTGGGACTCCATT
GTCGCCACATTATACACTACTCAGTCTTCTCATGAGGCAATAAATCAATTGATGGCGCACTGGGCTAGGATAAGT
CGTAACCGCTCCCAAAATTCCCAATCCACCACCACCGCTCTCCAAACATCTTCAGACGTTTGTCGAGATCGACCA
CGCGGCCAGAATCAACAACTTCAATGCACCAATCAAAATTGTGGTCGTCGAGGCCATACTATAGAGAATTGTTAC
TGGCCTGGCGGTGGAAAGGCCGGGCAATTTCCACCGGGTTTCGGCAAGCGTGGAGGAGTCAGAGGCTTGACGAAC
AATGCGGCATCAACTGGTCAAACGTCAGCCAACACAGCTAGTAGTGATAATGGGAATGGGAACAACAAACCGACA
GTTTTCGCTCTAGCAACCATAACACCAGAGGATGTTGATAGCGCATCCACTAGGGAAATCATAACCCTCCTCGAC
TCTGGTGCCAGCGATCATTGTATTGTCCAGAGGGATTATTTTGTCCAATATAAACCTATATCGCCACCGAGACTT
GGTAACTCAGCTAGTGAAGAATCAACGTTCAATATTGATGGATCTGGAACGGCTGTACTTTGGGTGCACAGAAAG
GAATCCACTTCGAAGATTCTTCTGGGAGATGCACTACATACTCCCCAACTTCGCTCAAATCTCATTTCTGTCTCG
AAACTTGTTGCCAAAGGTTTCAAGGTTAGCTTTGAGGGCGGATCTGCTGTCGTGCGTAGTGCTAGTGGAGAGACG
GTTTTGGAGGCGGCTAAAGCGAACGGACTCTATGTGATACCGGTGGGGACAAACACACCTAGCGCTAACGTCGTA
CAAGCGAGACGTAAGGCGGTTCCTTTTGACATTTGGCATCGTCGTTTTGGCCACGTTGGCGTTGATGTCCTCAAA
CGTATGGCTCGGGACAAGCTTGTGGATGGGCTGAATATTGAAGGAACGACTGAGATGATGGGAATGTGCGAGGAC
TGTATATATGGCGAACATGCTACTCACCCGTTCAACAACCAAGCTATCGCCGAGACTGAACCTCTCCAATGTGTC
TATATCGATATTTGGGGGCCGTCACCGGTACAGTCGGCCGGGGGAGCGAAATATTTCATGCTGATTATGGACGGT
GCCACATCGTACCGTAAGGTGTATTTCATCTCCAACAAGTCGGCTGAGGCGACGTTAGACGTCTTCAAAGAGTTC
CACCGAGAGGCAGAGCGTCAGACTGGGAAACGGCTCAAGCGGGTTAGGTTGGATATGGGGAGAGAGTGGCACAAC
AGGTTGCAGGACGAGTACGTAAAGAGTTATGGCATCGTTCTGGACTTCTCTACTCCCTATGCCCATCAACAGAAC
GGTAAAGCAGAGCGCTCGATGCGCACGCTGCTCGACATGGCCCGAACTCTCCTCTCTGATTCAGGTCTTCCCCAG
AAATATTGGGCTGACTCTGTTCAGACAGCCGTTTACTTGCGCAACTTCATACCTTTCACTCGCCAACCTGACCAC
ATACCCGCTGAGCGTTGGCTCGGGCACCGCCAGGACGTGTCCCACTTGCGGCCGTTCGGTTCCACATGTTATGCC
CACGTTCCTGTCGAGGCAAGTCCCAGCAAGCTCTCCCCACATTCCGTCAAGCTTACACTCATTGGTTTCTTTGAC
CATACTGGGTACAAACTACTTGTCCGTTCTACTGGGAAGGCTTTCCGTTCACGTGACGTCATATTCGAGGAGTCC
AAGCCTCATTACTCTACGGATCCCCTCATTACCTATCCCTCCGACAATGACAACGCCACACGGCCCTCTGATACT
TTCGTTGCGCCCCAACCGAAACATATCACTTTGTTACACCCACCTGCCATATCTACTCCTAGTACCACACCTGTG
ACTACACCTGCGGTGCCTATTTCGACGGCCGAAGGCGACTCGGATGTGACACCGGTTGTAGACTCCTCTGCAACT
GTTAGACGGTCTCAACGCAACCGTAAACCCTCTCAGAAGATGTTGGACAGTATGGAATACCTTGGGCGGCCCATG
GCTGGGGTCGCTACCATTCACGACGATCTCATCGTACCAAAGTCATATTGTGATGCGATGAAGAGAGCTGATTTG
TGGGTACCGCCGATGCTTAAAGAGTTGACCATGATGAAGGAAAAGGGAGTCTTCAAGCTCGTTCCTCGTCCGGTC
GGCAAGAACGTGGTGAAATCTAGATGGGTTTTCGCTAACAAGTACAATGAGGCGGGGGAGGCGATAGATCGCAAA
GCCAGGCTAGTTGCTAAAGGATTTACCCAGGTCCTGGGTGAAGATTACGACGAGACATATGCTTCTGTGGCTCGT
CTCGAGTCTGTTCGGCTGGTCTGCACTGTGGCGGCAGCTCGGCGGATGAGGCTGTGGCAACTGGATTTCATCTCT
GCTTTCCTCAACAGTGATAACGTCTTTGAGATATACATGGAGCAGCCACAGGGTTTTGAGGAAGGGGGAGACAAT
GTGTGGTTACTCCTCAAAACTTTATACGGTACCATGCAGGGCGCCCACGATTGGGCTTTCAACCTCAACCGCACA
TATGAAGGCCACGGATATTATGTATCTCGAGCAGATTCTCAGATTCGTTCGAAGGTTGAAGATACAGAATTTACC
CTTACGTCGACATGGACGGATGATGTACTTGGAGCTTCGTCTACGGAATTGGGGGAGAAGAAAGCTAAGGAGGAG
TTGGGGAACAGTTATGAGGTCAAGGATTTGGGAGCTGCGAAGTTTATATTGGGAATGAAGATTGAACGTGATGAA
AAGGACGGTACTATACGTTTATCACAGCGGTCTTACTGTGAACGTATCCTAGATCGCTTCAACATGGGGGACGCT
ACACCTAAATCGACACTGCTACCTCCCGGCATAGATCTCTCAACTGCTGATTCGGTACCAAGGTCAGAAGACGAA
ATGACTGAGATGGAAGGGGTGCCGTATCGAGAGGCGTTGGGATCTTTAATGTGGCTACAGGTAGCTACAAGACCG
GACCTGTCATTCGCCGTGAATCTGCTGTCTAGGTTTGCGAACAATCCCGGAAGGACCCAATGGAACGCCATGAAA
CACGCACTTGCCTATGTCAAAGGTACTTTGGACTATGGCATCACTTACTATCCAGACTCTACTCTACAACCATAT
GGTTATGTCGACACCGATTTTGCGGGTGATTGTGATTCCCGACGTTCAACTGAGGGACACATTTTCTTCGTGGCA
GGAGGACCAGTCTCCTGGGCAAGCAAACATCAGGAAACTGTTGCCCTTTCGACGGTGGAGGCTGAGTATATGGCT
TTCACGTGTGCGGTTCAGCAAGCAGTCTGGCTCGACAAGTTCCTTTATGAAATAGATTTGGCCCAGCAACGTCCG
TTCACTATCTACGCTGACAACAATGGTGCTATCGCTAACACCACCAATGACCGCAATCATCGTCGCACCAAACAC
ATTGACATCAAGCATCACTTTATCAAAGAGAAAGTCGCAGACAACTCGGTCGTTTTCAGTTATATCCCCTCTTCC
GAGAACCTTGCCGACATCCTTACCAAGGCTCTTCCTCGTGACGCAGTCCTTCGTATTTGTTTCCATTTCGGTCTG
ATAGCGCAGTCCTAA
Transcript >AgabiH97|030810
ATGTCCGGTATGGGTGGAAACACACCTCCCATGTTCGCCGACACGGCGAAATTCAATGGAAATAACTGGGTCTCT
TGGAACAACCTCATCCGTATAGCTGCTGAGCTTCGTGGTGTTTCTGGATACTTGGACGGTTCAATCATTAATCCT
ACAAGCAATCCGTTGAATGTGCCCTTACCTTCCTCACCGCCTGACACTACTACTTCACAGACCACATCTCCAACT
TCTACGCCGACAGAAACCTCATGGGAGTCTACAACTCCAAGCACTGCTGAATGGAAAGTGCGTAACGCATGGGCA
AAGGGCTTACTCATCTACAATACCGACGACCCAGTTGGCCTCGGCATAAACATACATGGTAGTGCCGCCGAAGCC
TGGAAATCATATGTGGACACATACGAAGTAGCGTCAGAAGTCGCGCTACTAAACGCCGAGTTGGAATTACACAAT
ATGCTCTATGCTGATGATCAGGACTTTGTTCAATATATCTCTAAACTTCGTACCAAGTGGTCTAATGCAACGGCT
TTGGGAGCGAAGATTGACGATAAAGCTTTCCGCACCATCATACTCAACTCACTTCCCCGTTCTTGGGACTCCATT
GTCGCCACATTATACACTACTCAGTCTTCTCATGAGGCAATAAATCAATTGATGGCGCACTGGGCTAGGATAAGT
CGTAACCGCTCCCAAAATTCCCAATCCACCACCACCGCTCTCCAAACATCTTCAGACGTTTGTCGAGATCGACCA
CGCGGCCAGAATCAACAACTTCAATGCACCAATCAAAATTGTGGTCGTCGAGGCCATACTATAGAGAATTGTTAC
TGGCCTGGCGGTGGAAAGGCCGGGCAATTTCCACCGGGTTTCGGCAAGCGTGGAGGAGTCAGAGGCTTGACGAAC
AATGCGGCATCAACTGGTCAAACGTCAGCCAACACAGCTAGTAGTGATAATGGGAATGGGAACAACAAACCGACA
GTTTTCGCTCTAGCAACCATAACACCAGAGGATGTTGATAGCGCATCCACTAGGGAAATCATAACCCTCCTCGAC
TCTGGTGCCAGCGATCATTGTATTGTCCAGAGGGATTATTTTGTCCAATATAAACCTATATCGCCACCGAGACTT
GGTAACTCAGCTAGTGAAGAATCAACGTTCAATATTGATGGATCTGGAACGGCTGTACTTTGGGTGCACAGAAAG
GAATCCACTTCGAAGATTCTTCTGGGAGATGCACTACATACTCCCCAACTTCGCTCAAATCTCATTTCTGTCTCG
AAACTTGTTGCCAAAGGTTTCAAGGTTAGCTTTGAGGGCGGATCTGCTGTCGTGCGTAGTGCTAGTGGAGAGACG
GTTTTGGAGGCGGCTAAAGCGAACGGACTCTATGTGATACCGGTGGGGACAAACACACCTAGCGCTAACGTCGTA
CAAGCGAGACGTAAGGCGGTTCCTTTTGACATTTGGCATCGTCGTTTTGGCCACGTTGGCGTTGATGTCCTCAAA
CGTATGGCTCGGGACAAGCTTGTGGATGGGCTGAATATTGAAGGAACGACTGAGATGATGGGAATGTGCGAGGAC
TGTATATATGGCGAACATGCTACTCACCCGTTCAACAACCAAGCTATCGCCGAGACTGAACCTCTCCAATGTGTC
TATATCGATATTTGGGGGCCGTCACCGGTACAGTCGGCCGGGGGAGCGAAATATTTCATGCTGATTATGGACGGT
GCCACATCGTACCGTAAGGTGTATTTCATCTCCAACAAGTCGGCTGAGGCGACGTTAGACGTCTTCAAAGAGTTC
CACCGAGAGGCAGAGCGTCAGACTGGGAAACGGCTCAAGCGGGTTAGGTTGGATATGGGGAGAGAGTGGCACAAC
AGGTTGCAGGACGAGTACGTAAAGAGTTATGGCATCGTTCTGGACTTCTCTACTCCCTATGCCCATCAACAGAAC
GGTAAAGCAGAGCGCTCGATGCGCACGCTGCTCGACATGGCCCGAACTCTCCTCTCTGATTCAGGTCTTCCCCAG
AAATATTGGGCTGACTCTGTTCAGACAGCCGTTTACTTGCGCAACTTCATACCTTTCACTCGCCAACCTGACCAC
ATACCCGCTGAGCGTTGGCTCGGGCACCGCCAGGACGTGTCCCACTTGCGGCCGTTCGGTTCCACATGTTATGCC
CACGTTCCTGTCGAGGCAAGTCCCAGCAAGCTCTCCCCACATTCCGTCAAGCTTACACTCATTGGTTTCTTTGAC
CATACTGGGTACAAACTACTTGTCCGTTCTACTGGGAAGGCTTTCCGTTCACGTGACGTCATATTCGAGGAGTCC
AAGCCTCATTACTCTACGGATCCCCTCATTACCTATCCCTCCGACAATGACAACGCCACACGGCCCTCTGATACT
TTCGTTGCGCCCCAACCGAAACATATCACTTTGTTACACCCACCTGCCATATCTACTCCTAGTACCACACCTGTG
ACTACACCTGCGGTGCCTATTTCGACGGCCGAAGGCGACTCGGATGTGACACCGGTTGTAGACTCCTCTGCAACT
GTTAGACGGTCTCAACGCAACCGTAAACCCTCTCAGAAGATGTTGGACAGTATGGAATACCTTGGGCGGCCCATG
GCTGGGGTCGCTACCATTCACGACGATCTCATCGTACCAAAGTCATATTGTGATGCGATGAAGAGAGCTGATTTG
TGGGTACCGCCGATGCTTAAAGAGTTGACCATGATGAAGGAAAAGGGAGTCTTCAAGCTCGTTCCTCGTCCGGTC
GGCAAGAACGTGGTGAAATCTAGATGGGTTTTCGCTAACAAGTACAATGAGGCGGGGGAGGCGATAGATCGCAAA
GCCAGGCTAGTTGCTAAAGGATTTACCCAGGTCCTGGGTGAAGATTACGACGAGACATATGCTTCTGTGGCTCGT
CTCGAGTCTGTTCGGCTGGTCTGCACTGTGGCGGCAGCTCGGCGGATGAGGCTGTGGCAACTGGATTTCATCTCT
GCTTTCCTCAACAGTGATAACGTCTTTGAGATATACATGGAGCAGCCACAGGGTTTTGAGGAAGGGGGAGACAAT
GTGTGGTTACTCCTCAAAACTTTATACGGTACCATGCAGGGCGCCCACGATTGGGCTTTCAACCTCAACCGCACA
TATGAAGGCCACGGATATTATGTATCTCGAGCAGATTCTCAGATTCGTTCGAAGGTTGAAGATACAGAATTTACC
CTTACGTCGACATGGACGGATGATGTACTTGGAGCTTCGTCTACGGAATTGGGGGAGAAGAAAGCTAAGGAGGAG
TTGGGGAACAGTTATGAGGTCAAGGATTTGGGAGCTGCGAAGTTTATATTGGGAATGAAGATTGAACGTGATGAA
AAGGACGGTACTATACGTTTATCACAGCGGTCTTACTGTGAACGTATCCTAGATCGCTTCAACATGGGGGACGCT
ACACCTAAATCGACACTGCTACCTCCCGGCATAGATCTCTCAACTGCTGATTCGGTACCAAGGTCAGAAGACGAA
ATGACTGAGATGGAAGGGGTGCCGTATCGAGAGGCGTTGGGATCTTTAATGTGGCTACAGGTAGCTACAAGACCG
GACCTGTCATTCGCCGTGAATCTGCTGTCTAGGTTTGCGAACAATCCCGGAAGGACCCAATGGAACGCCATGAAA
CACGCACTTGCCTATGTCAAAGGTACTTTGGACTATGGCATCACTTACTATCCAGACTCTACTCTACAACCATAT
GGTTATGTCGACACCGATTTTGCGGGTGATTGTGATTCCCGACGTTCAACTGAGGGACACATTTTCTTCGTGGCA
GGAGGACCAGTCTCCTGGGCAAGCAAACATCAGGAAACTGTTGCCCTTTCGACGGTGGAGGCTGAGTATATGGCT
TTCACGTGTGCGGTTCAGCAAGCAGTCTGGCTCGACAAGTTCCTTTATGAAATAGATTTGGCCCAGCAACGTCCG
TTCACTATCTACGCTGACAACAATGGTGCTATCGCTAACACCACCAATGACCGCAATCATCGTCGCACCAAACAC
ATTGACATCAAGCATCACTTTATCAAAGAGAAAGTCGCAGACAACTCGGTCGTTTTCAGTTATATCCCCTCTTCC
GAGAACCTTGCCGACATCCTTACCAAGGCTCTTCCTCGTGACGCAGTCCTTCGTATTTGTTTCCATTTCGGTCTG
ATAGCGCAGTCCTAA
Gene >AgabiH97|030810
ATGTCCGGTATGGGTGGAAACACACCTCCCATGTTCGCCGACACGGCGAAATTCAATGGAAATAACTGGGTCTCT
TGGAACAACCTCATCCGTATAGCTGCTGAGCTTCGTGGTGTTTCTGGATACTTGGACGGTTCAATCATTAATCCT
ACAAGCAATCCGTTGAATGTGCCCTTACCTTCCTCACCGCCTGACACTACTACTTCACAGACCACATCTCCAACT
TCTACGCCGACAGAAACCTCATGGGAGTCTACAACTCCAAGCACTGCTGAATGGAAAGTGCGTAACGCATGGGCA
AAGGGCTTACTCATCTACAATACCGACGACCCAGTTGGCCTCGGCATAAACATACATGGTAGTGCCGCCGAAGCC
TGGAAATCATATGTGGACACATACGAAGTAGCGTCAGAAGTCGCGCTACTAAACGCCGAGTTGGAATTACACAAT
ATGCTCTATGCTGATGATCAGGACTTTGTTCAATATATCTCTAAACTTCGTACCAAGTGGTCTAATGCAACGGCT
TTGGGAGCGAAGATTGACGATAAAGCTTTCCGCACCATCATACTCAACTCACTTCCCCGTTCTTGGGACTCCATT
GTCGCCACATTATACACTACTCAGTCTTCTCATGAGGCAATAAATCAATTGATGGCGCACTGGGCTAGGATAAGT
CGTAACCGCTCCCAAAATTCCCAATCCACCACCACCGCTCTCCAAACATCTTCAGACGTTTGTCGAGATCGACCA
CGCGGCCAGAATCAACAACTTCAATGCACCAATCAAAATTGTGGTCGTCGAGGCCATACTATAGAGAATTGTTAC
TGGCCTGGCGGTGGAAAGGCCGGGCAATTTCCACCGGGTTTCGGCAAGCGTGGAGGAGTCAGAGGCTTGACGAAC
AATGCGGCATCAACTGGTCAAACGTCAGCCAACACAGCTAGTAGTGATAATGGGAATGGGAACAACAAACCGACA
GTTTTCGCTCTAGCAACCATAACACCAGAGGATGTTGATAGCGCATCCACTAGGGAAATCATAACCCTCCTCGAC
TCTGGTGCCAGCGATCATTGTATTGTCCAGAGGGATTATTTTGTCCAATATAAACCTATATCGCCACCGAGACTT
GGTAACTCAGCTAGTGAAGAATCAACGTTCAATATTGATGGATCTGGAACGGCTGTACTTTGGGTGCACAGAAAG
GAATCCACTTCGAAGATTCTTCTGGGAGATGCACTACATACTCCCCAACTTCGCTCAAATCTCATTTCTGTCTCG
AAACTTGTTGCCAAAGGTTTCAAGGTTAGCTTTGAGGGCGGATCTGCTGTCGTGCGTAGTGCTAGTGGAGAGACG
GTTTTGGAGGCGGCTAAAGCGAACGGACTCTATGTGATACCGGTGGGGACAAACACACCTAGCGCTAACGTCGTA
CAAGCGAGACGTAAGGCGGTTCCTTTTGACATTTGGCATCGTCGTTTTGGCCACGTTGGCGTTGATGTCCTCAAA
CGTATGGCTCGGGACAAGCTTGTGGATGGGCTGAATATTGAAGGAACGACTGAGATGATGGGAATGTGCGAGGAC
TGTATATATGGCGAACATGCTACTCACCCGTTCAACAACCAAGCTATCGCCGAGACTGAACCTCTCCAATGTGTC
TATATCGATATTTGGGGGCCGTCACCGGTACAGTCGGCCGGGGGAGCGAAATATTTCATGCTGATTATGGACGGT
GCCACATCGTACCGTAAGGTGTATTTCATCTCCAACAAGTCGGCTGAGGCGACGTTAGACGTCTTCAAAGAGTTC
CACCGAGAGGCAGAGCGTCAGACTGGGAAACGGCTCAAGCGGGTTAGGTTGGATATGGGGAGAGAGTGGCACAAC
AGGTTGCAGGACGAGTACGTAAAGAGTTATGGCATCGTTCTGGACTTCTCTACTCCCTATGCCCATCAACAGAAC
GGTAAAGCAGAGCGCTCGATGCGCACGCTGCTCGACATGGCCCGAACTCTCCTCTCTGATTCAGGTCTTCCCCAG
AAATATTGGGCTGACTCTGTTCAGACAGCCGTTTACTTGCGCAACTTCATACCTTTCACTCGCCAACCTGACCAC
ATACCCGCTGAGCGTTGGCTCGGGCACCGCCAGGACGTGTCCCACTTGCGGCCGTTCGGTTCCACATGTTATGCC
CACGTTCCTGTCGAGGCAAGTCCCAGCAAGCTCTCCCCACATTCCGTCAAGCTTACACTCATTGGTTTCTTTGAC
CATACTGGGTACAAACTACTTGTCCGTTCTACTGGGAAGGCTTTCCGTTCACGTGACGTCATATTCGAGGAGTCC
AAGCCTCATTACTCTACGGATCCCCTCATTACCTATCCCTCCGACAATGACAACGCCACACGGCCCTCTGATACT
TTCGTTGCGCCCCAACCGAAACATATCACTTTGTTACACCCACCTGCCATATCTACTCCTAGTACCACACCTGTG
ACTACACCTGCGGTGCCTATTTCGACGGCCGAAGGCGACTCGGATGTGACACCGGTTGTAGACTCCTCTGCAACT
GTTAGACGGTCTCAACGCAACCGTAAACCCTCTCAGAAGATGTTGGACAGTATGGAATACCTTGGGCGGCCCATG
GCTGGGGTCGCTACCATTCACGACGATCTCATCGTACCAAAGTCATATTGTGATGCGATGAAGAGAGCTGATTTG
TGGGTACCGCCGATGCTTAAAGAGTTGACCATGATGAAGGAAAAGGGAGTCTTCAAGCTCGTTCCTCGTCCGGTC
GGCAAGAACGTGGTGAAATCTAGATGGGTTTTCGCTAACAAGTACAATGAGGCGGGGGAGGCGATAGATCGCAAA
GCCAGGCTAGTTGCTAAAGGATTTACCCAGGTCCTGGGTGAAGATTACGACGAGACATATGCTTCTGTGGCTCGT
CTCGAGTCTGTTCGGCTGGTCTGCACTGTGGCGGCAGCTCGGCGGATGAGGCTGTGGCAACTGGATTTCATCTCT
GCTTTCCTCAACAGTGATAACGTCTTTGAGATATACATGGAGCAGCCACAGGGTTTTGAGGAAGGGGGAGACAAT
GTGTGGTTACTCCTCAAAACTTTATACGGTACCATGCAGGGCGCCCACGATTGGGCTTTCAACCTCAACCGCACA
TATGAAGGCCACGGATATTATGTATCTCGAGCAGATTCTCAGATTCGTTCGAAGGTTGAAGATACAGAATTTACC
CTTACGTCGACATGGACGGATGATGTACTTGGAGCTTCGTCTACGGAATTGGGGGAGAAGAAAGCTAAGGAGGAG
TTGGGGAACAGTTATGAGGTCAAGGATTTGGGAGCTGCGAAGTTTATATTGGGAATGAAGATTGAACGTGATGAA
AAGGACGGTACTATACGTTTATCACAGCGGTCTTACTGTGAACGTATCCTAGATCGCTTCAACATGGGGGACGCT
ACACCTAAATCGACACTGCTACCTCCCGGCATAGATCTCTCAACTGCTGATTCGGTACCAAGGTCAGAAGACGAA
ATGACTGAGATGGAAGGGGTGCCGTATCGAGAGGCGTTGGGATCTTTAATGTGGCTACAGGTAGCTACAAGACCG
GACCTGTCATTCGCCGTGAATCTGCTGTCTAGGTTTGCGAACAATCCCGGAAGGACCCAATGGAACGCCATGAAA
CACGCACTTGCCTATGTCAAAGGTACTTTGGACTATGGCATCACTTACTATCCAGACTCTACTCTACAACCATAT
GGTTATGTCGACACCGATTTTGCGGGTGATTGTGATTCCCGACGTTCAACTGAGGGACACATTTTCTTCGTGGCA
GGAGGACCAGTCTCCTGGGCAAGCAAACATCAGGAAACTGTTGCCCTTTCGACGGTGGAGGCTGAGTATATGGCT
TTCACGTGTGCGGTTCAGCAAGCAGTCTGGCTCGACAAGTTCCTTTATGAAATAGATTTGGCCCAGCAACGTCCG
TTCACTATCTACGCTGACAACAATGGTGCTATCGCTAACACCACCAATGACCGCAATCATCGTCGCACCAAACAC
ATTGACATCAAGCATCACTTTATCAAAGAGAAAGTCGCAGACAACTCGGTCGTTTTCAGTTATATCCCCTCTTCC
GAGAACCTTGCCGACATCCTTACCAAGGCTCTTCCTCGTGACGCAGTCCTTCGTATTTGTTTCCATTTCGGTCTG
ATAGCGCAGTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail