Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|030510
Gene name
Locationscaffold_12:637019..638013
Strand+
Gene length (bp)994
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.0E-13 62 156
PF13489 Methyltransf_23 Methyltransferase domain 2.9E-11 47 210
PF08241 Methyltransf_11 Methyltransferase domain 1.9E-09 63 158
PF13847 Methyltransf_31 Methyltransferase domain 2.2E-07 57 175
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.0E-04 60 165

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6662 0.5419 0.0635 0.0499 0.0774 0.013 0.1934 0.1617 0.1294 0.0068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 65.87 36.68 95.07
Initials Initials knots 78.65 45.92 111.38
Pileal_Stipeal_center Stage I stipe center 101.45 60.37 142.52
Pileal_Stipeal_shell Stage I stipe shell 411.20 229.46 592.94
DIF_stipe_center Stage II stipe center 35.58 19.27 51.88
DIF_stipe_shell Stage II stipe shell 36.15 19.68 52.61
DIF_stipe_skin Stage II stipe skin 128.47 76.07 180.87
DIF_cap_skin Stage II cap skin 545.12 302.52 787.73
DIF_cap_tissue Stage II cap tissue 372.40 211.00 533.80
DIF_gill_tissue Stage II gill tissue 275.64 157.31 393.97
YFB_stipe_center Young fruiting body stipe center 91.36 45.03 137.68
YFB_stipe_shell Young fruiting body stipe shell 37.69 20.00 55.38
YFB_stipe_skin Young fruiting body stipe skin 92.12 53.89 130.36
YFB_cap_skin Young fruiting body cap skin 426.32 241.82 610.82
YFB_cap_tissue Young fruiting body cap tissue 120.51 70.77 170.25
YFB_gill_tissue Young fruiting body gill tissue 296.74 171.27 422.21
YFB_veil Young fruiting body veil 298.42 156.76 440.08

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.399849 no
Casing YFB_stipe_shell 0.076262 no
Casing YFB_stipe_skin 0.330123 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.033906 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.684297 no
Casing Pileal_Stipeal_center 0.165549 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.043121 yes
Casing DIF_stipe_shell 0.044631 yes
Casing DIF_stipe_skin 0.017783 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.162357 no
DIF_gill_tissue YFB_cap_tissue 0.001625 yes
DIF_gill_tissue YFB_gill_tissue 0.890738 no
DIF_gill_tissue YFB_veil 0.892813 no
YFB_stipe_center YFB_stipe_shell 0.004548 yes
YFB_stipe_center YFB_stipe_skin 0.988350 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.471961 no
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.002525 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.433516 no
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.263990 no
YFB_cap_skin YFB_veil 0.314783 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.991559 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.762188 no
Initials YFB_stipe_shell 0.008121 yes
Initials YFB_stipe_skin 0.712976 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.149200 no
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.472590 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.002951 yes
Initials DIF_stipe_shell 0.003365 yes
Initials DIF_stipe_skin 0.077343 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.840240 no
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.841674 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.663042 no
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.495833 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.212600 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.950703 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.335232 no
Pileal_Stipeal_shell YFB_veil 0.386814 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.443780 no
Pileal_Stipeal_shell DIF_cap_tissue 0.845683 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.002525 yes
DIF_stipe_center YFB_stipe_shell 0.925586 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.979049 no
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.002084 yes
DIF_stipe_shell YFB_stipe_shell 0.946657 no
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.000613 yes
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.003765 yes
DIF_stipe_skin YFB_stipe_center 0.335794 no
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.296798 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.900470 no
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.001625 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.016104 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.512543 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.028193 yes
DIF_cap_skin YFB_veil 0.044844 yes
DIF_cap_skin DIF_cap_tissue 0.237009 no
DIF_cap_tissue DIF_gill_tissue 0.385946 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.768964 no
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.552355 no
DIF_cap_tissue YFB_veil 0.599428 no

Orthologs

Orthofinder run ID1
Orthogroup288
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|023670
Agaricus bisporus var bisporus H39 AgabiH39|030510
Agaricus bisporus var bisporus H39 AgabiH39|062930
Agaricus bisporus var bisporus H39 AgabiH39|062940
Agaricus bisporus var bisporus H39 AgabiH39|062950
Agaricus bisporus var bisporus H39 AgabiH39|062970
Agaricus bisporus var bisporus H39 AgabiH39|062990
Agaricus bisporus var bisporus H39 AgabiH39|069420
Agaricus bisporus var bisporus H39 AgabiH39|294900
Agaricus bisporus var bisporus H39 AgabiH39|387000
Agaricus bisporus var bisporus H97 AgabiH97|069430
Agaricus bisporus var bisporus H97 AgabiH97|069420
Agaricus bisporus var bisporus H97 AgabiH97|062990
Agaricus bisporus var bisporus H97 AgabiH97|062970
Agaricus bisporus var bisporus H97 AgabiH97|062960
Agaricus bisporus var bisporus H97 AgabiH97|023670
Agaricus bisporus var bisporus H97 AgabiH97|062940
Agaricus bisporus var bisporus H97 AgabiH97|062930
Agaricus bisporus var bisporus H97 AgabiH97|030510 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|096710
Agaricus bisporus var bisporus H97 AgabiH97|062950
Rhodonia placenta FPRL280 RhoplFPRL280|71_4

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|030510
MIQAGIQHTVTRQYTQVKGTAYSLPHDAEEQRRLTLQSDVFLRATDNKVLHAPIKLNDDDRVLETATGTGIWLQD
LARETHAKPQYTGVDIESAFFPKASTLPPNMRFETQSVTALPSEWTNHFSLVHQRLLIAALRRHEWGTALKEIYR
VLKPGGWVQLLEMQGWTSGPALAKHTDLLFKFSDDVGIMYRDIAKRLPDFLEESGFANIHQDPRGTPLGAWAGTD
GVDGKEVLMGVLEGLKTPILRKGGYGIIESETEYDALLKEISEELDNTPGSVAKWTMFWAQKPLE*
Coding >AgabiH97|030510
ATGATCCAAGCAGGTATCCAGCATACAGTGACTCGCCAGTATACCCAAGTCAAGGGTACAGCGTATTCCTTGCCA
CATGACGCAGAAGAACAGCGAAGGTTGACGTTACAGAGCGATGTGTTTCTCCGTGCAACGGATAACAAGGTTCTC
CACGCGCCCATCAAACTCAATGACGATGATCGAGTTCTGGAGACTGCTACTGGCACAGGTATTTGGCTTCAGGAC
CTAGCAAGAGAGACGCATGCGAAGCCACAGTACACCGGTGTTGATATCGAATCGGCTTTCTTCCCAAAAGCCTCT
ACTCTTCCCCCCAATATGCGATTTGAAACCCAATCCGTCACTGCCCTTCCAAGCGAATGGACAAACCACTTTAGT
CTCGTTCATCAACGTCTCCTTATTGCTGCGCTCCGCAGGCACGAATGGGGAACGGCTCTCAAAGAAATCTACCGA
GTTCTCAAACCAGGTGGATGGGTGCAACTTTTAGAAATGCAGGGATGGACTTCCGGCCCTGCACTCGCTAAACAT
ACGGATCTGCTTTTTAAGTTTTCGGATGATGTGGGGATTATGTATCGTGATATCGCTAAGCGACTACCCGATTTT
CTGGAGGAGAGCGGTTTTGCCAATATTCATCAGGACCCCCGTGGTACTCCTCTTGGTGCCTGGGCCGGTACTGAT
GGTGTCGACGGGAAGGAGGTTCTCATGGGTGTCTTAGAAGGGCTCAAAACGCCTATTTTGAGAAAGGGTGGTTAT
GGTATCATCGAGAGCGAAACCGAGTACGATGCACTGTTAAAAGAAATCTCGGAGGAGTTGGACAACACGCCGGGA
TCAGTGGCCAAGTGGACGATGTTCTGGGCACAGAAACCGCTTGAGTAG
Transcript >AgabiH97|030510
ATGATCCAAGCAGGTATCCAGCATACAGTGACTCGCCAGTATACCCAAGTCAAGGGTACAGCGTATTCCTTGCCA
CATGACGCAGAAGAACAGCGAAGGTTGACGTTACAGAGCGATGTGTTTCTCCGTGCAACGGATAACAAGGTTCTC
CACGCGCCCATCAAACTCAATGACGATGATCGAGTTCTGGAGACTGCTACTGGCACAGGTATTTGGCTTCAGGAC
CTAGCAAGAGAGACGCATGCGAAGCCACAGTACACCGGTGTTGATATCGAATCGGCTTTCTTCCCAAAAGCCTCT
ACTCTTCCCCCCAATATGCGATTTGAAACCCAATCCGTCACTGCCCTTCCAAGCGAATGGACAAACCACTTTAGT
CTCGTTCATCAACGTCTCCTTATTGCTGCGCTCCGCAGGCACGAATGGGGAACGGCTCTCAAAGAAATCTACCGA
GTTCTCAAACCAGGTGGATGGGTGCAACTTTTAGAAATGCAGGGATGGACTTCCGGCCCTGCACTCGCTAAACAT
ACGGATCTGCTTTTTAAGTTTTCGGATGATGTGGGGATTATGTATCGTGATATCGCTAAGCGACTACCCGATTTT
CTGGAGGAGAGCGGTTTTGCCAATATTCATCAGGACCCCCGTGGTACTCCTCTTGGTGCCTGGGCCGGTACTGAT
GGTGTCGACGGGAAGGAGGTTCTCATGGGTGTCTTAGAAGGGCTCAAAACGCCTATTTTGAGAAAGGGTGGTTAT
GGTATCATCGAGAGCGAAACCGAGTACGATGCACTGTTAAAAGAAATCTCGGAGGAGTTGGACAACACGCCGGGA
TCAGTGGCCAAGTGGACGATGTTCTGGGCACAGAAACCGCTTGAGTAG
Gene >AgabiH97|030510
ATGATCCAAGCAGGTATCCAGCATACAGTGACTCGCCAGTATACCCAAGTCAAGGGTACAGCGTATTCCTTGCCA
CATGACGCAGAAGAACAGCGAAGGTGAGCAGCTTTAACTATGCATTCATTTCTTCTTTTACTCATTATCGTTGTA
AGGTTGACGTTACAGAGCGATGTGTTTCTCCGTGCAACGGATAACAAGGTTCTCCACGCGCCCATCAAACTCAAT
GACGATGATCGAGTTCTGGAGACTGCTACTGGCACAGGTAAGAATTCTCTCCTCTCCCAAGTCCAAGGGGGAAGA
AAGCTAAATGAGTAATTATCGCCCAATAGGTATTTGGCTTCAGGACCTAGCAAGAGAGACGCATGCGAAGCCACA
GTACACCGGTGTTGATATCGAATCGGCTTTCTTCCCAAAAGCCTCTACTCTTCCCCCCAATATGCGATTTGAAAC
CCAATCCGTCACTGCCCTTCCAAGCGAATGGACAAACCACTTTAGTCTCGTTCATCAACGTCTCCTTATTGCTGC
GCTCCGCAGGCACGAATGGGGAACGGCTCTCAAAGAAATCTACCGAGTTCTCAAACCAGGTGGATGGGTGCAACT
TTTAGAAATGCAGGGATGGACTTCCGGCCCTGCACTCGCTAAACATACGGATCTGCTTTTTAAGTTTTCGGATGA
TGTGGGGATTATGTATCGTGATATCGCTAAGCGACTACCCGATTTTCTGGAGGAGAGCGGTTTTGCCAATATTCA
TCAGGACCCCCGTGGTACTCCTCTTGGTGCCTGGGCCGGTACTGATGGTGTCGACGGGAAGGAGGTTCTCATGGG
TGTCTTAGAAGGGCTCAAAACGCCTATTTTGAGAAAGGGTGGTTATGGTATCATCGAGAGCGAAACCGAGTACGA
TGCACTGTTAAAAGAAATCTCGGAGGAGTTGGACAACACGCCGGGATCAGTGGCCAAGTGGACGATGTTCTGGGC
ACAGAAACCGCTTGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail