Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|030500
Gene name
Locationscaffold_12:633284..634827
Strand-
Gene length (bp)1543
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CHX6|MBTP2_MOUSE Membrane-bound transcription factor site-2 protease OS=Mus musculus GN=Mbtps2 PE=2 SV=1 49 387 2.0E-23
sp|O54862|MBTP2_CRIGR Membrane-bound transcription factor site-2 protease OS=Cricetulus griseus GN=MBTPS2 PE=2 SV=1 58 387 5.0E-22
sp|O43462|MBTP2_HUMAN Membrane-bound transcription factor site-2 protease OS=Homo sapiens GN=MBTPS2 PE=1 SV=1 49 387 9.0E-22
sp|Q0III2|MBTP2_BOVIN Membrane-bound transcription factor site-2 protease OS=Bos taurus GN=MBTPS2 PE=2 SV=1 45 387 3.0E-21
sp|Q5RAC8|MBTP2_PONAB Membrane-bound transcription factor site-2 protease OS=Pongo abelii GN=MBTPS2 PE=2 SV=1 49 387 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CHX6|MBTP2_MOUSE Membrane-bound transcription factor site-2 protease OS=Mus musculus GN=Mbtps2 PE=2 SV=1 49 387 2.0E-23
sp|O54862|MBTP2_CRIGR Membrane-bound transcription factor site-2 protease OS=Cricetulus griseus GN=MBTPS2 PE=2 SV=1 58 387 5.0E-22
sp|O43462|MBTP2_HUMAN Membrane-bound transcription factor site-2 protease OS=Homo sapiens GN=MBTPS2 PE=1 SV=1 49 387 9.0E-22
sp|Q0III2|MBTP2_BOVIN Membrane-bound transcription factor site-2 protease OS=Bos taurus GN=MBTPS2 PE=2 SV=1 45 387 3.0E-21
sp|Q5RAC8|MBTP2_PONAB Membrane-bound transcription factor site-2 protease OS=Pongo abelii GN=MBTPS2 PE=2 SV=1 49 387 4.0E-21
sp|F4JUU5|S2P_ARATH Membrane-bound transcription factor site-2 protease homolog OS=Arabidopsis thaliana GN=S2P PE=2 SV=2 53 389 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 98 120 22
2 141 163 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|030500
MVVALGLLLWTTWTLIKPFSFHKIVNVSKSVGKLMMKRDIPEVTYTEQLAPQSPITPILPGVTVPLNHLPFILTT
LFLSQLIHELGHAIAGALYNIPILSSGASLVICIPAAFVSYSTTALDTLRPPAKSRIISAGPFHNLLFWCFCFLT
SYIGSGLFWTFIGYKDISALGRLVLQVEDDSPLAGHLTTGAIITKLNDHSLASSSIDPDPWTSFLKSTKNDDIFL
GWCIDSNALDSSGKECCLPDESKKDTLSCFVANTVPTRVGCMDPIPILTSTKTTDRCESGTDCRNGHVCVRPAET
EELLRLTIKGNELEPDKVVLWSGPREEVWNEVTVGVWRPRLSFLPIRLPLWGSVFWEYLMMVNLSLFLFNLLPLG
NLDGQHFLHSMMLSSNKDDVFNLVSLERAETPDESRWGMLEKVICRGTGVLVALDSVLTLLALIRI*
Coding >AgabiH97|030500
ATGGTGGTCGCGCTGGGATTGCTACTATGGACGACATGGACGCTCATAAAACCATTTTCCTTTCACAAAATCGTC
AACGTCTCAAAATCGGTTGGCAAACTGATGATGAAGAGAGACATCCCGGAGGTTACCTACACCGAACAATTGGCC
CCGCAGAGTCCCATTACACCCATCTTACCAGGAGTCACCGTCCCATTAAACCACCTCCCCTTCATCCTCACCACC
CTTTTCCTAAGTCAACTGATCCACGAATTAGGCCACGCCATCGCCGGTGCTCTATACAACATTCCCATCCTCTCC
TCCGGTGCATCTCTCGTCATCTGTATACCCGCCGCATTCGTCTCATATTCAACAACTGCTCTCGATACCCTTCGT
CCTCCCGCTAAATCGCGTATCATTTCCGCCGGTCCATTTCACAATTTACTGTTCTGGTGTTTTTGTTTTTTGACT
TCTTACATTGGGAGTGGGTTGTTTTGGACGTTTATAGGATATAAAGACATCAGTGCGTTGGGTCGACTTGTACTT
CAAGTTGAAGATGATTCGCCTCTGGCAGGACATTTGACGACGGGGGCTATAATAACAAAGCTAAATGACCACTCC
TTGGCATCTTCTTCCATAGACCCCGATCCTTGGACCTCGTTTCTCAAATCCACCAAGAATGACGACATCTTCCTT
GGTTGGTGCATCGACTCAAACGCACTCGATTCCTCAGGGAAGGAGTGCTGTCTACCCGACGAATCCAAAAAAGAC
ACACTGTCGTGTTTCGTGGCGAACACGGTTCCAACCCGAGTCGGGTGCATGGATCCTATCCCTATATTAACGTCT
ACAAAGACGACAGACAGATGTGAATCGGGAACAGATTGCCGAAATGGACATGTCTGCGTGAGGCCCGCGGAGACG
GAGGAATTATTGAGGCTGACAATCAAAGGAAATGAACTGGAGCCTGATAAAGTTGTACTCTGGAGCGGACCTCGT
GAAGAAGTCTGGAATGAAGTGACTGTTGGCGTATGGCGACCTCGACTGAGTTTCCTTCCAATCCGCTTGCCCCTT
TGGGGAAGTGTGTTCTGGGAGTATCTTATGATGGTCAATCTGTCTCTTTTCCTGTTCAACCTTCTTCCGCTTGGG
AACTTGGATGGACAACATTTCCTTCATTCAATGATGCTGTCGTCCAACAAAGACGATGTATTTAATCTGGTATCA
TTGGAAAGAGCAGAGACGCCCGATGAAAGTCGATGGGGAATGTTGGAAAAGGTGATTTGTAGGGGTACGGGAGTG
TTGGTAGCACTGGACAGTGTATTGACTCTATTAGCGTTAATTCGCATATGA
Transcript >AgabiH97|030500
ATGGTGGTCGCGCTGGGATTGCTACTATGGACGACATGGACGCTCATAAAACCATTTTCCTTTCACAAAATCGTC
AACGTCTCAAAATCGGTTGGCAAACTGATGATGAAGAGAGACATCCCGGAGGTTACCTACACCGAACAATTGGCC
CCGCAGAGTCCCATTACACCCATCTTACCAGGAGTCACCGTCCCATTAAACCACCTCCCCTTCATCCTCACCACC
CTTTTCCTAAGTCAACTGATCCACGAATTAGGCCACGCCATCGCCGGTGCTCTATACAACATTCCCATCCTCTCC
TCCGGTGCATCTCTCGTCATCTGTATACCCGCCGCATTCGTCTCATATTCAACAACTGCTCTCGATACCCTTCGT
CCTCCCGCTAAATCGCGTATCATTTCCGCCGGTCCATTTCACAATTTACTGTTCTGGTGTTTTTGTTTTTTGACT
TCTTACATTGGGAGTGGGTTGTTTTGGACGTTTATAGGATATAAAGACATCAGTGCGTTGGGTCGACTTGTACTT
CAAGTTGAAGATGATTCGCCTCTGGCAGGACATTTGACGACGGGGGCTATAATAACAAAGCTAAATGACCACTCC
TTGGCATCTTCTTCCATAGACCCCGATCCTTGGACCTCGTTTCTCAAATCCACCAAGAATGACGACATCTTCCTT
GGTTGGTGCATCGACTCAAACGCACTCGATTCCTCAGGGAAGGAGTGCTGTCTACCCGACGAATCCAAAAAAGAC
ACACTGTCGTGTTTCGTGGCGAACACGGTTCCAACCCGAGTCGGGTGCATGGATCCTATCCCTATATTAACGTCT
ACAAAGACGACAGACAGATGTGAATCGGGAACAGATTGCCGAAATGGACATGTCTGCGTGAGGCCCGCGGAGACG
GAGGAATTATTGAGGCTGACAATCAAAGGAAATGAACTGGAGCCTGATAAAGTTGTACTCTGGAGCGGACCTCGT
GAAGAAGTCTGGAATGAAGTGACTGTTGGCGTATGGCGACCTCGACTGAGTTTCCTTCCAATCCGCTTGCCCCTT
TGGGGAAGTGTGTTCTGGGAGTATCTTATGATGGTCAATCTGTCTCTTTTCCTGTTCAACCTTCTTCCGCTTGGG
AACTTGGATGGACAACATTTCCTTCATTCAATGATGCTGTCGTCCAACAAAGACGATGTATTTAATCTGGTATCA
TTGGAAAGAGCAGAGACGCCCGATGAAAGTCGATGGGGAATGTTGGAAAAGGTGATTTGTAGGGGTACGGGAGTG
TTGGTAGCACTGGACAGTGTATTGACTCTATTAGCGTTAATTCGCATATGA
Gene >AgabiH97|030500
ATGGTGGTCGCGCTGGGATTGCTACTATGGACGACATGGACGCTCATAAAACCATTTTCCTTTCACAAAATCGTC
AACGTCTCAAAATCGGTTGGCAAACTGATGATGAAGAGAGACATCCCGGAGGTTACCTACACCGAACAATTGGCC
CCGCAGAGTCCCATTACACCCATCGTAAGGCCGAATTTCATCCTCCAAACCTATCCTAATCCTCTTCAAATAACA
GTTACCAGGAGTCACCGTCCCATTAAACCACCTCCCCTTCATCCTCACCACCCTTTTCCTAAGTCAACTGATCCA
CGAATTAGGCCACGCCATCGCCGGTGCTCTATACAACATTCCCATCCTCTCCTCCGGTGCATCTCTCGTCATCTG
TATACCCGCCGCATTCGTCTCATATTCAACAACTGCTCTCGATACCCTTCGTCCTCCCGCTAAATCGCGTATCAT
TTCCGCCGGTCCATTTCACAATTTACTGTTCTGGTGTTTTTGTTTTTTGACTTCTTACATTGGGAGTGGGTTGTT
TTGGACGTTTATAGGATATAAAGACATCAGTGCGTTGGGTCGACTTGTACTTCAAGTTGAAGATGTGCGTGTGCC
GGAATATCTCTTCCCTTCTGCGCTGACTGGTCTCCCCAGGATTCGCCTCTGGCAGGACATTTGACGACGGGGGCT
ATAATAACAAAGCTAAATGACCACTCCTTGGCATCTTCTTCCATAGACCCCGATCCTTGGACCTCGTTTCTCAAA
TCCACCAAGAATGACGACATCTTCCTTGGTTGGTGCATCGACTCAAACGCACTCGATTCCTCAGGGAAGGAGTGC
TGTCTACCCGACGAATCCAAAAAAGACACACTGTCGTGTTTCGTGGCGAACACGGTTCCAACCCGAGTCGGGTGC
ATGGATCCTATCCCTATATTAACGTCTACAAAGACGACAGACAGATGTGAATCGGGAACAGATTGCCGAAATGGA
CATGTCTGCGTGAGGCCCGCGGAGACGGAGGAATTATTGAGGCTGACAATCAAAGGAAATGAACTGGAGCCTGAT
AAAGTTGTACTCTGGAGCGGACCTCGTGAAGAAGTCTGGAATGAAGGCAAGTAACCAATCTCCGCCTTGGAGACG
ATCTGTAATGGACTTTTTTTTTTTTAGTGACTGTTGGCGTATGGCGACCTCGACTGAGTTTCCTTCCAATCCGCT
TGCCCCTTTGGGGAAGTGTGTTCTGGGAGTAAGTTTCACTCTGTGTACTCTATGTTTCGCGTTTTTACTCAGTGG
TTGGCGTCTCAGGTATCTTATGATGGTCAATCTGTCTCTTTTCCTGTTCAACCTTCTTCCGCTTGGGAACTTGGA
TGGACAACATTTCCTTCATTCAATGATGCTGTCGTCCAACAAAGACGATGTATTTAATCTGGTATCATTGGAAAG
AGCAGAGACGCCCGATGAAAGTCGATGGGGAATGTTGGAAAAGGTGATTTGTAGGGGTACGGGAGTGTTGGTAGC
ACTGGACAGTGTATTGACTCTATTAGCGTTAATTCGCATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail