Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|030460
Gene name
Locationscaffold_12:622339..625419
Strand-
Gene length (bp)3080
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 9.1E-46 25 199
PF05199 GMC_oxred_C GMC oxidoreductase 5.5E-23 637 765
PF00732 GMC_oxred_N GMC oxidoreductase 6.1E-22 239 539
PF00890 FAD_binding_2 FAD binding domain 1.2E-05 240 272
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.6E-06 243 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01738|CDH_PHACH Cellobiose dehydrogenase OS=Phanerochaete chrysosporium GN=CDH-1 PE=1 SV=1 7 776 0.0E+00
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 239 770 2.0E-19
sp|Q7MF12|BETA_VIBVY Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betA PE=3 SV=1 239 770 9.0E-18
sp|Q8D3K2|BETA_VIBVU Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betA PE=3 SV=1 239 770 1.0E-17
sp|Q1MJU4|BETA_RHIL3 Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1 240 770 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01738|CDH_PHACH Cellobiose dehydrogenase OS=Phanerochaete chrysosporium GN=CDH-1 PE=1 SV=1 7 776 0.0E+00
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 239 770 2.0E-19
sp|Q7MF12|BETA_VIBVY Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betA PE=3 SV=1 239 770 9.0E-18
sp|Q8D3K2|BETA_VIBVU Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betA PE=3 SV=1 239 770 1.0E-17
sp|Q1MJU4|BETA_RHIL3 Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1 240 770 1.0E-16
sp|Q6LGH5|BETA_PHOPR Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum GN=betA PE=3 SV=1 237 770 2.0E-16
sp|Q47944|SDH_GLUOY L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans PE=3 SV=1 239 765 2.0E-16
sp|B5ZUG2|BETA_RHILW Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betA PE=3 SV=1 240 770 4.0E-16
sp|Q2KB43|BETA_RHIEC Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betA PE=3 SV=1 240 770 3.0E-15
sp|Q02DZ0|BETA_PSEAB Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betA PE=3 SV=1 239 769 7.0E-15
sp|Q9HTJ2|BETA_PSEAE Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=betA PE=3 SV=1 239 769 8.0E-15
sp|B7V5R3|BETA_PSEA8 Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=betA PE=3 SV=1 239 769 8.0E-15
sp|B9JBA2|BETA_AGRRK Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betA PE=3 SV=1 240 770 1.0E-14
sp|Q8UH55|BETA_AGRFC Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=betA PE=3 SV=2 240 770 1.0E-14
sp|A6VEI3|BETA_PSEA7 Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betA PE=3 SV=1 239 769 2.0E-14
sp|B3PTE0|BETA_RHIE6 Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=betA PE=3 SV=1 240 770 2.0E-14
sp|Q4L9D7|BETA_STAHJ Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=betA PE=3 SV=1 239 766 4.0E-14
sp|C3MIE4|BETA_RHISN Oxygen-dependent choline dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betA PE=3 SV=1 240 770 6.0E-14
sp|B7N8L3|BETA_ECOLU Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betA PE=3 SV=1 239 764 9.0E-14
sp|B6I074|BETA_ECOSE Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SE11) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|A7ZWV4|BETA_ECOHS Oxygen-dependent choline dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|B7M2V5|BETA_ECO8A Oxygen-dependent choline dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|B7L439|BETA_ECO55 Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|A7ZI50|BETA_ECO24 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|Q0T7N0|BETA_SHIF8 Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|P17444|BETA_ECOLI Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12) GN=betA PE=1 SV=1 239 764 2.0E-13
sp|B1J0W6|BETA_ECOLC Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|B1XE52|BETA_ECODH Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betA PE=3 SV=1 239 764 2.0E-13
sp|B7UJG4|BETA_ECO27 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=betA PE=3 SV=1 239 764 3.0E-13
sp|Q8FKI9|BETA_ECOL6 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=betA PE=3 SV=2 239 764 4.0E-13
sp|Q8X6C6|BETA_ECO57 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O157:H7 GN=betA PE=3 SV=1 239 764 5.0E-13
sp|B5Z1R0|BETA_ECO5E Oxygen-dependent choline dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=betA PE=3 SV=1 239 764 5.0E-13
sp|B1LIJ7|BETA_ECOSM Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betA PE=3 SV=1 239 764 5.0E-13
sp|A4XPI5|BETA_PSEMY Oxygen-dependent choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betA PE=3 SV=1 239 769 7.0E-13
sp|Q48CM7|BETA_PSE14 Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betA PE=3 SV=1 235 769 1.0E-12
sp|Q0TKW1|BETA_ECOL5 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betA PE=3 SV=2 239 764 2.0E-12
sp|Q3L243|PDH2_LEUMG Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris GN=pdh2 PE=2 SV=1 226 769 2.0E-12
sp|Q1RFM3|BETA_ECOUT Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=betA PE=3 SV=2 239 764 2.0E-12
sp|B7MCD0|BETA_ECO45 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=betA PE=3 SV=1 239 764 2.0E-12
sp|Q4ZM63|BETA_PSEU2 Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betA PE=3 SV=1 235 769 4.0E-12
sp|A6X2G7|BETA_OCHA4 Oxygen-dependent choline dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=betA PE=3 SV=1 240 770 4.0E-12
sp|B4EHJ2|BETA_BURCJ Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=betA PE=3 SV=1 234 769 6.0E-12
sp|A6U6Y8|BETA_SINMW Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betA PE=3 SV=1 240 770 9.0E-12
sp|P18173|DHGL_DROME Glucose dehydrogenase [FAD, quinone] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 239 764 1.0E-11
sp|A0B2F7|BETA_BURCH Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=betA PE=3 SV=1 234 769 2.0E-11
sp|Q1BQE2|BETA_BURCA Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=betA PE=3 SV=1 234 769 2.0E-11
sp|B1K707|BETA_BURCC Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=betA PE=3 SV=1 234 769 2.0E-11
sp|Q8YFY2|BETA_BRUME Oxygen-dependent choline dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betA PE=3 SV=2 240 770 3.0E-11
sp|Q39A44|BETA_BURL3 Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=betA PE=3 SV=1 234 769 5.0E-11
sp|B0CKN4|BETA_BRUSI Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betA PE=3 SV=1 240 770 6.0E-11
sp|A5VPA6|BETA_BRUO2 Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betA PE=3 SV=1 240 770 6.0E-11
sp|Q8G1Z8|BETA_BRUSU Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betA PE=3 SV=1 240 770 6.0E-11
sp|Q4A0Q1|BETA_STAS1 Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=betA PE=3 SV=1 239 766 6.0E-11
sp|B1Z034|BETA_BURA4 Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=betA PE=3 SV=1 234 769 7.0E-11
sp|A9M9H8|BETA_BRUC2 Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betA PE=3 SV=1 240 770 7.0E-11
sp|Q0B711|BETA_BURCM Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=betA PE=3 SV=1 234 769 2.0E-10
sp|B2JS89|BETA_BURP8 Oxygen-dependent choline dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betA PE=3 SV=1 234 769 4.0E-10
sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=1 SV=2 239 543 4.0E-10
sp|Q88AE7|BETA_PSESM Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betA PE=3 SV=1 235 769 3.0E-09
sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 224 541 2.0E-07
sp|V5NDL4|PDH1_AGACM Pyranose dehydrogenase OS=Agaricus campestris GN=pdh1 PE=1 SV=1 239 765 2.0E-07
sp|Q985M5|BETA_RHILO Oxygen-dependent choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1 240 770 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 23.54 12.91 34.17
Initials Initials knots 13.04 7.20 18.87
Pileal_Stipeal_center Stage I stipe center 22.52 13.19 31.84
Pileal_Stipeal_shell Stage I stipe shell 22.73 13.28 32.17
DIF_stipe_center Stage II stipe center 21.24 12.36 30.11
DIF_stipe_shell Stage II stipe shell 20.61 11.95 29.27
DIF_stipe_skin Stage II stipe skin 18.54 10.54 26.54
DIF_cap_skin Stage II cap skin 22.01 12.86 31.17
DIF_cap_tissue Stage II cap tissue 25.61 15.13 36.08
DIF_gill_tissue Stage II gill tissue 23.08 13.55 32.62
YFB_stipe_center Young fruiting body stipe center 13.42 7.45 19.39
YFB_stipe_shell Young fruiting body stipe shell 14.74 8.26 21.23
YFB_stipe_skin Young fruiting body stipe skin 16.12 9.15 23.09
YFB_cap_skin Young fruiting body cap skin 23.10 13.54 32.65
YFB_cap_tissue Young fruiting body cap tissue 27.61 16.37 38.84
YFB_gill_tissue Young fruiting body gill tissue 22.05 12.75 31.35
YFB_veil Young fruiting body veil 23.42 13.72 33.13

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.972413 no
Casing YFB_stipe_center 0.061086 no
Casing YFB_stipe_shell 0.135297 no
Casing YFB_stipe_skin 0.261033 no
Casing YFB_cap_skin 0.974349 no
Casing YFB_cap_tissue 0.712030 no
Casing YFB_gill_tissue 0.906547 no
Casing YFB_veil 0.992883 no
Casing Initials 0.040947 yes
Casing Pileal_Stipeal_center 0.938379 no
Casing Pileal_Stipeal_shell 0.951886 no
Casing DIF_stipe_center 0.836375 no
Casing DIF_stipe_shell 0.772091 no
Casing DIF_stipe_skin 0.533516 no
Casing DIF_cap_skin 0.901094 no
Casing DIF_cap_tissue 0.869671 no
DIF_gill_tissue YFB_stipe_center 0.063570 no
DIF_gill_tissue YFB_stipe_shell 0.136312 no
DIF_gill_tissue YFB_stipe_skin 0.274660 no
DIF_gill_tissue YFB_cap_skin 0.999148 no
DIF_gill_tissue YFB_cap_tissue 0.655960 no
DIF_gill_tissue YFB_gill_tissue 0.935181 no
DIF_gill_tissue YFB_veil 0.979720 no
YFB_stipe_center YFB_stipe_shell 0.858325 no
YFB_stipe_center YFB_stipe_skin 0.671216 no
YFB_stipe_center YFB_cap_skin 0.058926 no
YFB_stipe_center YFB_cap_tissue 0.008121 yes
YFB_stipe_center YFB_gill_tissue 0.096464 no
YFB_stipe_center YFB_veil 0.049467 yes
YFB_stipe_shell YFB_stipe_skin 0.866629 no
YFB_stipe_shell YFB_cap_skin 0.141262 no
YFB_stipe_shell YFB_cap_tissue 0.019987 yes
YFB_stipe_shell YFB_gill_tissue 0.204470 no
YFB_stipe_shell YFB_veil 0.122322 no
YFB_stipe_skin YFB_cap_skin 0.268668 no
YFB_stipe_skin YFB_cap_tissue 0.058926 no
YFB_stipe_skin YFB_gill_tissue 0.365313 no
YFB_stipe_skin YFB_veil 0.245761 no
YFB_cap_skin YFB_cap_tissue 0.651386 no
YFB_cap_skin YFB_gill_tissue 0.932677 no
YFB_cap_skin YFB_veil 0.979757 no
YFB_cap_tissue YFB_gill_tissue 0.550084 no
YFB_cap_tissue YFB_veil 0.688260 no
YFB_gill_tissue YFB_veil 0.909610 no
Initials DIF_gill_tissue 0.049674 yes
Initials YFB_stipe_center 0.962682 no
Initials YFB_stipe_shell 0.803672 no
Initials YFB_stipe_skin 0.609135 no
Initials YFB_cap_skin 0.050085 no
Initials YFB_cap_tissue 0.007092 yes
Initials YFB_gill_tissue 0.077698 no
Initials YFB_veil 0.040501 yes
Initials Pileal_Stipeal_center 0.062420 no
Initials Pileal_Stipeal_shell 0.059906 no
Initials DIF_stipe_center 0.106032 no
Initials DIF_stipe_shell 0.140560 no
Initials DIF_stipe_skin 0.298054 no
Initials DIF_cap_skin 0.078590 no
Initials DIF_cap_tissue 0.013782 yes
Pileal_Stipeal_center DIF_gill_tissue 0.964055 no
Pileal_Stipeal_center YFB_stipe_center 0.078057 no
Pileal_Stipeal_center YFB_stipe_shell 0.164893 no
Pileal_Stipeal_center YFB_stipe_skin 0.316605 no
Pileal_Stipeal_center YFB_cap_skin 0.964132 no
Pileal_Stipeal_center YFB_cap_tissue 0.591403 no
Pileal_Stipeal_center YFB_gill_tissue 0.970760 no
Pileal_Stipeal_center YFB_veil 0.942964 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.986837 no
Pileal_Stipeal_center DIF_stipe_center 0.910403 no
Pileal_Stipeal_center DIF_stipe_shell 0.856552 no
Pileal_Stipeal_center DIF_stipe_skin 0.627523 no
Pileal_Stipeal_center DIF_cap_skin 0.967560 no
Pileal_Stipeal_center DIF_cap_tissue 0.772751 no
Pileal_Stipeal_shell DIF_gill_tissue 0.977852 no
Pileal_Stipeal_shell YFB_stipe_center 0.075194 no
Pileal_Stipeal_shell YFB_stipe_shell 0.153693 no
Pileal_Stipeal_shell YFB_stipe_skin 0.301262 no
Pileal_Stipeal_shell YFB_cap_skin 0.977504 no
Pileal_Stipeal_shell YFB_cap_tissue 0.619350 no
Pileal_Stipeal_shell YFB_gill_tissue 0.957054 no
Pileal_Stipeal_shell YFB_veil 0.957054 no
Pileal_Stipeal_shell DIF_stipe_center 0.893008 no
Pileal_Stipeal_shell DIF_stipe_shell 0.837368 no
Pileal_Stipeal_shell DIF_stipe_skin 0.607731 no
Pileal_Stipeal_shell DIF_cap_skin 0.953825 no
Pileal_Stipeal_shell DIF_cap_tissue 0.793947 no
DIF_stipe_center DIF_gill_tissue 0.865693 no
DIF_stipe_center YFB_stipe_center 0.127052 no
DIF_stipe_center YFB_stipe_shell 0.252194 no
DIF_stipe_center YFB_stipe_skin 0.443846 no
DIF_stipe_center YFB_cap_skin 0.868107 no
DIF_stipe_center YFB_cap_tissue 0.451220 no
DIF_stipe_center YFB_gill_tissue 0.946502 no
DIF_stipe_center YFB_veil 0.838703 no
DIF_stipe_center DIF_stipe_shell 0.956502 no
DIF_stipe_center DIF_stipe_skin 0.762381 no
DIF_stipe_center DIF_cap_skin 0.948175 no
DIF_stipe_center DIF_cap_tissue 0.634475 no
DIF_stipe_shell DIF_gill_tissue 0.807579 no
DIF_stipe_shell YFB_stipe_center 0.169965 no
DIF_stipe_shell YFB_stipe_shell 0.309085 no
DIF_stipe_shell YFB_stipe_skin 0.509225 no
DIF_stipe_shell YFB_cap_skin 0.809453 no
DIF_stipe_shell YFB_cap_tissue 0.379207 no
DIF_stipe_shell YFB_gill_tissue 0.900094 no
DIF_stipe_shell YFB_veil 0.776747 no
DIF_stipe_shell DIF_stipe_skin 0.827608 no
DIF_stipe_shell DIF_cap_skin 0.900393 no
DIF_stipe_shell DIF_cap_tissue 0.559424 no
DIF_stipe_skin DIF_gill_tissue 0.563702 no
DIF_stipe_skin YFB_stipe_center 0.348732 no
DIF_stipe_skin YFB_stipe_shell 0.547453 no
DIF_stipe_skin YFB_stipe_skin 0.758119 no
DIF_stipe_skin YFB_cap_skin 0.562185 no
DIF_stipe_skin YFB_cap_tissue 0.183181 no
DIF_stipe_skin YFB_gill_tissue 0.683175 no
DIF_stipe_skin YFB_veil 0.531182 no
DIF_stipe_skin DIF_cap_skin 0.679638 no
DIF_stipe_skin DIF_cap_tissue 0.318876 no
DIF_cap_skin DIF_gill_tissue 0.930507 no
DIF_cap_skin YFB_stipe_center 0.096464 no
DIF_cap_skin YFB_stipe_shell 0.198297 no
DIF_cap_skin YFB_stipe_skin 0.360945 no
DIF_cap_skin YFB_cap_skin 0.930360 no
DIF_cap_skin YFB_cap_tissue 0.530712 no
DIF_cap_skin YFB_gill_tissue 0.997093 no
DIF_cap_skin YFB_veil 0.906383 no
DIF_cap_skin DIF_cap_tissue 0.720783 no
DIF_cap_tissue DIF_gill_tissue 0.823199 no
DIF_cap_tissue YFB_stipe_center 0.022369 yes
DIF_cap_tissue YFB_stipe_shell 0.048626 yes
DIF_cap_tissue YFB_stipe_skin 0.124851 no
DIF_cap_tissue YFB_cap_skin 0.827157 no
DIF_cap_tissue YFB_cap_tissue 0.880358 no
DIF_cap_tissue YFB_gill_tissue 0.730049 no
DIF_cap_tissue YFB_veil 0.853782 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|030460
MRLLHILSGLLPFVGKALAQVGAPYVDPDNGISFFGSTELGSNVRTGYVFPPSDSTGDLANEFIGEIVSPVGTAW
VGLSPIGTMLQALLLVAWVNDGKIVSSVRFATDYVQPFPFDGPVLTTLPTSMINSTHWKWVYRCQNCVTWPLTTG
GTRSIPVNSGGVTAWSRSSVPVDNPSDPDSTFLEHETFGFYGADWTQAHVSASLYNNWASGGTGGGTVPTPTTTP
TTSDPGPTVTGTPYDYIVVGAGAGGLVAADRLSEAGKKVLLLERGGPSLGQFGGDDQESWVQGTKLTKFDVPGAF
ESMFNDADPWYWCKDITVFAGCLLGGGTAINGALFWHPPDSDFRNNNYPSSWENHNQYTNKMISRIPGTDHPSTD
GKRYGFEAMTIMQDMLRNQGYTQITINDNPNHKDHVYGYPSYSFFNGKRGGPITTYFASAMKRSNFVYKDNTMAL
SVVRDGGKITGVKTNNRNLGPDGVIPLTSKGRVILSAGTFGTARLLFRSGIGPSEQLQIVEANPDAAKDLPDSSD
YINLPVGHNIMDHPSINLVFTHPTIDAYNNWATVWTNPRPQDAAQYVRDQSGILAQSSTRVNFWRAYSRPEGGTQ
WVQGTVHPGSCCFTTDFDYDANKTITITLYLSTGLKSRGRIGIDAAMTMQPIDDPWLTDKNDEAVLWQAVQDTFS
TYKNVSNLVMISPDSTTTLQQFFKDYPRSSMGSNHWMGSAIMGSSASNSVVDQNTKVWRTDNLFVIDASIIPGLP
MTNPHGTIMAMAEQAVAKVLALSGGP*
Coding >AgabiH97|030460
ATGAGGCTACTGCACATCCTCTCTGGTCTCCTCCCCTTTGTGGGCAAAGCCTTGGCACAAGTCGGTGCTCCCTAC
GTTGATCCTGACAACGGAATTTCTTTCTTTGGTTCAACAGAACTCGGTAGCAACGTGCGCACTGGTTATGTCTTC
CCTCCTTCAGACTCTACTGGAGACCTCGCGAACGAATTCATCGGTGAAATCGTCTCTCCCGTCGGAACAGCTTGG
GTCGGTTTGTCTCCAATTGGAACCATGCTTCAGGCCCTTCTCTTGGTCGCCTGGGTCAACGACGGCAAGATTGTC
TCTTCAGTCCGCTTCGCCACCGACTATGTCCAACCATTCCCATTCGATGGACCAGTCTTAACTACCTTGCCAACG
TCGATGATCAATTCCACCCACTGGAAGTGGGTATACAGGTGCCAGAACTGCGTCACCTGGCCACTCACCACAGGA
GGAACTCGTTCCATCCCTGTCAATAGTGGTGGTGTCACCGCCTGGTCCCGCTCTAGTGTTCCTGTCGACAACCCA
TCCGATCCCGACAGTACTTTCCTCGAACACGAAACATTCGGCTTTTATGGCGCAGATTGGACCCAAGCTCATGTG
TCTGCATCACTTTACAATAATTGGGCTTCAGGTGGCACCGGCGGTGGAACTGTTCCCACTCCCACCACCACCCCC
ACGACAAGTGATCCTGGCCCAACCGTCACAGGCACACCATACGATTACATCGTCGTAGGTGCTGGTGCCGGTGGT
CTCGTCGCTGCAGATCGTCTTTCAGAAGCTGGAAAGAAAGTCCTTTTGCTTGAGCGTGGTGGTCCTTCTCTAGGT
CAATTCGGCGGTGATGACCAAGAATCCTGGGTACAAGGAACAAAACTTACAAAGTTTGATGTTCCCGGAGCTTTC
GAATCTATGTTCAATGATGCTGATCCATGGTACTGGTGCAAAGATATTACAGTTTTTGCCGGATGCTTGCTTGGA
GGTGGTACTGCCATCAATGGTGCCCTCTTCTGGCATCCTCCCGACTCCGACTTCAGAAACAATAATTATCCTTCA
TCTTGGGAAAACCACAACCAATACACTAACAAGATGATTTCTCGTATCCCCGGCACAGACCATCCTTCAACCGAT
GGCAAGCGCTATGGATTCGAAGCTATGACCATCATGCAAGACATGCTCAGAAATCAAGGATACACACAAATTACG
ATTAATGACAACCCCAACCACAAGGACCACGTTTATGGTTATCCCTCATACAGCTTCTTTAACGGCAAACGTGGT
GGCCCCATCACCACCTACTTTGCATCCGCCATGAAGCGTAGCAACTTTGTCTACAAAGACAACACTATGGCTCTC
TCAGTCGTTCGCGATGGTGGCAAGATCACTGGTGTCAAGACTAACAACCGAAATCTCGGACCTGACGGTGTCATC
CCCCTCACTTCCAAAGGTCGTGTCATCCTTTCTGCAGGTACATTCGGTACCGCTCGCCTCTTGTTCCGCAGCGGC
ATTGGTCCCAGCGAACAACTCCAAATTGTCGAGGCCAATCCTGATGCTGCTAAAGACCTCCCCGACTCTTCGGAT
TATATTAACTTGCCTGTTGGACATAACATTATGGACCATCCTTCGATTAACCTTGTCTTCACACATCCGACAATT
GACGCGTACAATAATTGGGCCACCGTCTGGACGAACCCTCGTCCCCAAGACGCCGCTCAATACGTCAGAGATCAG
TCTGGTATCCTCGCCCAATCCTCTACTCGTGTCAACTTTTGGCGAGCATACAGCCGCCCCGAAGGTGGAACACAA
TGGGTACAAGGAACAGTTCATCCTGGTTCTTGCTGCTTCACTACCGATTTCGACTATGATGCCAATAAGACCATA
ACAATCACACTTTATCTCTCTACTGGTCTAAAATCTCGTGGACGCATTGGCATTGACGCTGCTATGACCATGCAA
CCCATCGATGACCCATGGCTTACAGACAAAAATGACGAAGCGGTTCTATGGCAGGCTGTTCAGGATACCTTTAGC
ACGTACAAGAATGTCTCTAACCTCGTTATGATCAGCCCAGACAGCACTACTACTCTACAACAGTTTTTCAAGGAT
TATCCTAGGAGTAGCATGGGTTCGAATCACTGGATGGGTAGTGCAATTATGGGTTCAAGTGCCTCGAACTCTGTC
GTCGATCAGAATACCAAGGTTTGGCGAACAGACAATCTATTTGTCATCGATGCTTCCATCATACCTGGTTTGCCC
ATGACTAACCCGCATGGTACCATCATGGCTATGGCGGAACAAGCTGTAGCCAAAGTTCTTGCATTGTCTGGTGGA
CCTTGA
Transcript >AgabiH97|030460
ATGAGGCTACTGCACATCCTCTCTGGTCTCCTCCCCTTTGTGGGCAAAGCCTTGGCACAAGTCGGTGCTCCCTAC
GTTGATCCTGACAACGGAATTTCTTTCTTTGGTTCAACAGAACTCGGTAGCAACGTGCGCACTGGTTATGTCTTC
CCTCCTTCAGACTCTACTGGAGACCTCGCGAACGAATTCATCGGTGAAATCGTCTCTCCCGTCGGAACAGCTTGG
GTCGGTTTGTCTCCAATTGGAACCATGCTTCAGGCCCTTCTCTTGGTCGCCTGGGTCAACGACGGCAAGATTGTC
TCTTCAGTCCGCTTCGCCACCGACTATGTCCAACCATTCCCATTCGATGGACCAGTCTTAACTACCTTGCCAACG
TCGATGATCAATTCCACCCACTGGAAGTGGGTATACAGGTGCCAGAACTGCGTCACCTGGCCACTCACCACAGGA
GGAACTCGTTCCATCCCTGTCAATAGTGGTGGTGTCACCGCCTGGTCCCGCTCTAGTGTTCCTGTCGACAACCCA
TCCGATCCCGACAGTACTTTCCTCGAACACGAAACATTCGGCTTTTATGGCGCAGATTGGACCCAAGCTCATGTG
TCTGCATCACTTTACAATAATTGGGCTTCAGGTGGCACCGGCGGTGGAACTGTTCCCACTCCCACCACCACCCCC
ACGACAAGTGATCCTGGCCCAACCGTCACAGGCACACCATACGATTACATCGTCGTAGGTGCTGGTGCCGGTGGT
CTCGTCGCTGCAGATCGTCTTTCAGAAGCTGGAAAGAAAGTCCTTTTGCTTGAGCGTGGTGGTCCTTCTCTAGGT
CAATTCGGCGGTGATGACCAAGAATCCTGGGTACAAGGAACAAAACTTACAAAGTTTGATGTTCCCGGAGCTTTC
GAATCTATGTTCAATGATGCTGATCCATGGTACTGGTGCAAAGATATTACAGTTTTTGCCGGATGCTTGCTTGGA
GGTGGTACTGCCATCAATGGTGCCCTCTTCTGGCATCCTCCCGACTCCGACTTCAGAAACAATAATTATCCTTCA
TCTTGGGAAAACCACAACCAATACACTAACAAGATGATTTCTCGTATCCCCGGCACAGACCATCCTTCAACCGAT
GGCAAGCGCTATGGATTCGAAGCTATGACCATCATGCAAGACATGCTCAGAAATCAAGGATACACACAAATTACG
ATTAATGACAACCCCAACCACAAGGACCACGTTTATGGTTATCCCTCATACAGCTTCTTTAACGGCAAACGTGGT
GGCCCCATCACCACCTACTTTGCATCCGCCATGAAGCGTAGCAACTTTGTCTACAAAGACAACACTATGGCTCTC
TCAGTCGTTCGCGATGGTGGCAAGATCACTGGTGTCAAGACTAACAACCGAAATCTCGGACCTGACGGTGTCATC
CCCCTCACTTCCAAAGGTCGTGTCATCCTTTCTGCAGGTACATTCGGTACCGCTCGCCTCTTGTTCCGCAGCGGC
ATTGGTCCCAGCGAACAACTCCAAATTGTCGAGGCCAATCCTGATGCTGCTAAAGACCTCCCCGACTCTTCGGAT
TATATTAACTTGCCTGTTGGACATAACATTATGGACCATCCTTCGATTAACCTTGTCTTCACACATCCGACAATT
GACGCGTACAATAATTGGGCCACCGTCTGGACGAACCCTCGTCCCCAAGACGCCGCTCAATACGTCAGAGATCAG
TCTGGTATCCTCGCCCAATCCTCTACTCGTGTCAACTTTTGGCGAGCATACAGCCGCCCCGAAGGTGGAACACAA
TGGGTACAAGGAACAGTTCATCCTGGTTCTTGCTGCTTCACTACCGATTTCGACTATGATGCCAATAAGACCATA
ACAATCACACTTTATCTCTCTACTGGTCTAAAATCTCGTGGACGCATTGGCATTGACGCTGCTATGACCATGCAA
CCCATCGATGACCCATGGCTTACAGACAAAAATGACGAAGCGGTTCTATGGCAGGCTGTTCAGGATACCTTTAGC
ACGTACAAGAATGTCTCTAACCTCGTTATGATCAGCCCAGACAGCACTACTACTCTACAACAGTTTTTCAAGGAT
TATCCTAGGAGTAGCATGGGTTCGAATCACTGGATGGGTAGTGCAATTATGGGTTCAAGTGCCTCGAACTCTGTC
GTCGATCAGAATACCAAGGTTTGGCGAACAGACAATCTATTTGTCATCGATGCTTCCATCATACCTGGTTTGCCC
ATGACTAACCCGCATGGTACCATCATGGCTATGGCGGAACAAGCTGTAGCCAAAGTTCTTGCATTGTCTGGTGGA
CCTTGA
Gene >AgabiH97|030460
ATGAGGCTACTGCACATCCTCTCTGGTCTCCTCCCCTTTGTGGGCAAAGGTACAGACTTCTCCCATCTTCATGTC
CGCAAACTCCGTCTCATTCAACTCCAGCCTTGGCACAAGTCGGTGCTCCCTACGTTGATCCTGACAACGGAATTT
CTTTCTTTGGTTCAACAGAACTCGGTAGCAACGTGCGCACTGGTTATGTCTTCCCTCCTTCAGACTCTACTGGAG
ACCTCGCGAACGAATTCATCGGTGAAATCGTCTCTCCCGTCGGAACAGCTTGGGTCGGTTTGTCTCCAATTGGAA
CCATGCTTCAGGCCCTTCTCTTGGTCGCCTGGGTCAACGACGGCAAGATTGTCTCTTCAGTCCGCTTCGCCACGT
AAGTGGTGATTTTATTAAACTACAAAGAGCACCCATCTGATCTGGAGTAGCGACTATGTCCAACCATTGTAAGTT
GGCCTTTATGTCCTACAAGATACACGAGACCTATCTATTTTTTCCAGCCCATTCGATGGACCAGTCTTAACTACC
TTGCCAACGTCGATGATCAATTCCACCCACTGGAAGTGGGTATACAGGTGCCAGAACTGCGTCAGTAAGTGTGCA
TCGACCTGTTACTTCAAACATGTACTCACGAGCACCACCATCAGCCTGGCCACTCACCACAGGAGGAACTCGTTC
CATCCCTGTCAATAGTGGTGGTGTCACCGCCTGGTCCCGCTCTAGTGTTCCTGTCGACAACCCATCCGATCCCGA
CAGTACTTTCCTCGAACACGAAACATGTAAGTAAAAGCTTTATTTCATTCCCCGGCTATGACCACTGACAAGCCG
TTTCTAGTCGGCTTTTATGGCGCAGATTGGACCCAAGCTCATGTGTCTGCATCACTTTACAATAATTGGGCTTCA
GGTGGCACCGGCGGTGGAACTGTTCCCACTCCCACCACCACCCCCACGACAAGTGATCCTGGCCCAACCGTCACA
GGCACACCATACGATTACATCGTCGTAGGTGCTGGTGCCGGTGGTCTCGTCGCTGCAGATCGTCTTTCAGAAGCT
GGAAAGAAAGTCCTTTTGCTTGAGCGTGGTGGTCCTTCTCTAGGTCAATTCGGCGGTGATGACCAAGAATCCTGG
GTACAAGGAACAAAACTTACAAAGTTTGATGTTCCCGGAGCTTTCGGTGCGCATTTCTCAGCTTCGTCTCAATGA
CTCATGTTGAATGCTTTTCAGAATCTATGTTCAATGATGCTGATCCATGGTACTGGTGCAAAGATATTACAGTTT
TTGCCGGATGCTTGCTTGGAGGTGGTACTGCCATCAATGGTGCCCTCTTCTGGCATCCTCCCGACTCCGACTTCA
GAAACAATAATTATCCTTCATCTTGGGAAAACCACAACCAATACACTAACAAGATGATTTCTCGTATCCCCGGCA
CAGACCATCCTTCAACCGATGGCAAGCGCTATGGATTCGAAGCTATGACCATCATGCAAGACATGCTCAGAAATC
AAGGATACACACAAATTACGATTAATGACAACCCCAACCACAAGGACCACGTTTATGGTTATCCCTCATACAGCG
TCTGTGGAAGCTCGTCTTGTAACTGGAAAAAAACTTACTCATAGTGCATTTTTATAGTTCTTTAACGGCAAACGT
GGTGGCCCCATCACCACCTACTTTGCATCCGCCATGAAGCGTAGCAACTTTGTCTACAAAGACAACACTATGGCT
CTCTCAGTCGTTCGCGATGGTGGCAAGATCACTGGTGTCAAGACTAACAACCGAAATCTCGGACCTGACGGTGTC
ATCCCCCTCACTTCCAAAGGTCGTGTCATCCTTTCTGCAGGTACATTCGGTACCGCTCGCCTCTTGTTCCGCAGC
GGCATTGGTCCCAGCGAACAACTCCAAATTGTCGAGGCCAATCCTGATGCTGCTAAAGACCTCCCCGACTCTTCG
GATTATATTAACTTGCCTGTTGGACATAACATTATGGACCATCCTTCGATTAACGTGAGTAGCTTCACCGAAACT
CCACCTTTGAAATGTTGCTAATACTTGATTGTTAGCTTGTCTTCACACATCCGACAATTGACGCGTACAATAATT
GGGCCACCGTCTGGACGAACCCTCGTCCCCAAGACGCCGCTCAATACGTCAGAGATCAGTCTGGTATCCTCGCCC
AATCCTCTACTCGTGTCAACTTTTGGCGAGCATACAGCCGCCCCGAAGGTGGAACACAATGGGTCAGTCCCTTAA
TTGCTTTACGCAAACTCATCCTGAGTTGCGCCTCTTTCTAGGTACAAGGAACAGTTCATCCTGGTTCTTGCTGCT
TCACTACCGATTTCGACTATGATGCCAATAAGACCATAACAATCACACTTTATCTGTAAGCATGTCTTTTTTTCG
TTTCATTGTGAGAGTTCGTGCTGAAGTATATATATGTGTGTGTAGCTCTACTGGTCTAAAATCTCGTGGACGCAT
TGGCATTGACGCTGCTATGACCATGCAACCCATCGATGACCCATGGCTTACAGACAAAAATGACGAAGCGGTTCT
ATGGCAGGCTGTTCAGGATACCTTTAGCACGTACAAGAATGGTATGTTCCCTCCATTGACTATCATTTCCCTGCA
TTTGACTTAATATTTTCGGACGCTCTAGTCTCTAACCTCGTTATGATCAGCCCAGACAGCACTACTACTCTACAA
CAGTTTTTCAAGGATTATCCTAGGGTGCGTCTTATTTCCTGTACTATATCATAAAATCTTCGACATTAACTCCCT
GTCTGTGTTATAGAGTAGCATGGGTTCGAATCACTGGATGGGTAGTGCAATTATGGGTTCAAGTGCCTCGAACTC
TGTCGTCGATCAGAATACCAAGGTTTGGCGAACAGACAATCTATTTGTCATCGATGCTTCCATCGTACGTCCTTT
TGCATTTCTCTCCTCCTATTTAAACATTTCCTCATGCTTTTCTTTTCTTTTCTTTATAGATACCTGGTTTGCCCA
TGACTAACCCGCATGGTACCATCATGGCTATGGCGGAACAAGCTGTAGCCAAAGTTCTTGCATTGTCTGGTGGAC
CTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail