Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|030020
Gene name
Locationscaffold_12:490498..499811
Strand-
Gene length (bp)9313
Transcript length (bp)8055
Coding sequence length (bp)8055
Protein length (aa) 2685

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 1.2E-45 2542 2674
PF13639 zf-RING_2 Ring finger domain 1.7E-11 2410 2453
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.6E-06 2411 2452
PF13445 zf-RING_UBOX RING-type zinc-finger 3.1E-05 2411 2450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q94A97|UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1 2538 2684 9.0E-74
sp|Q9FZ48|UBC36_ARATH Ubiquitin-conjugating enzyme E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1 2538 2684 2.0E-73
sp|P35128|UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1 2538 2684 1.0E-69
sp|Q5R7J6|UBE2N_PONAB Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1 2539 2683 6.0E-66
sp|P61089|UBE2N_MOUSE Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1 2539 2683 6.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q94A97|UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1 2538 2684 9.0E-74
sp|Q9FZ48|UBC36_ARATH Ubiquitin-conjugating enzyme E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1 2538 2684 2.0E-73
sp|P35128|UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1 2538 2684 1.0E-69
sp|Q5R7J6|UBE2N_PONAB Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1 2539 2683 6.0E-66
sp|P61089|UBE2N_MOUSE Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1 2539 2683 6.0E-66
sp|P61088|UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens GN=UBE2N PE=1 SV=1 2539 2683 6.0E-66
sp|Q0P5K3|UBE2N_BOVIN Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN=UBE2N PE=2 SV=1 2539 2683 6.0E-66
sp|Q95XX0|UBC13_CAEEL Ubiquitin-conjugating enzyme E2 13 OS=Caenorhabditis elegans GN=ubc-13 PE=1 SV=2 2539 2683 7.0E-66
sp|Q9EQX9|UBE2N_RAT Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus GN=Ube2n PE=1 SV=1 2539 2683 9.0E-66
sp|Q86K32|UBE2N_DICDI Probable ubiquitin-conjugating enzyme E2 N OS=Dictyostelium discoideum GN=ube2n PE=3 SV=2 2538 2683 3.0E-65
sp|P52490|UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC13 PE=1 SV=1 2538 2683 1.0E-64
sp|Q4R4I1|UBE2N_MACFA Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1 2539 2683 2.0E-64
sp|O13685|UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc13 PE=1 SV=1 2537 2683 4.0E-61
sp|Q5JXB2|UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens GN=UBE2NL PE=1 SV=1 2539 2683 8.0E-57
sp|P70711|U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=1 SV=1 2541 2683 6.0E-40
sp|Q6ZWY6|U2D2B_MOUSE Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=1 SV=1 2541 2683 6.0E-40
sp|P35129|UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1 2541 2683 2.0E-39
sp|P52485|UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster GN=Ubc2 PE=2 SV=1 2541 2683 6.0E-39
sp|P46595|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc4 PE=1 SV=1 2541 2683 1.0E-38
sp|P62840|UB2D2_XENLA Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1 2541 2683 2.0E-38
sp|P62839|UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=1 SV=1 2541 2683 2.0E-38
sp|P62838|UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1 2541 2683 2.0E-38
sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1 2541 2683 2.0E-38
sp|Q1RMX2|UB2D2_BOVIN Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1 2541 2683 2.0E-38
sp|Q06AA9|UB2D2_PIG Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1 2541 2683 2.0E-38
sp|P61078|UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1 2541 2683 3.0E-38
sp|Q5R4V7|UB2D3_PONAB Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1 2541 2683 3.0E-38
sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=1 SV=1 2541 2683 3.0E-38
sp|Q4R5N4|UB2D3_MACFA Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1 2541 2683 3.0E-38
sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1 2541 2683 3.0E-38
sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1 2541 2683 3.0E-38
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1 2541 2683 4.0E-38
sp|A5PKP9|UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis GN=ube2d4 PE=1 SV=1 2541 2683 5.0E-38
sp|Q9UVR2|UBC1_MAGO7 Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBC1 PE=3 SV=2 2541 2683 5.0E-38
sp|P52483|UB2E3_MOUSE Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus GN=Ube2e3 PE=1 SV=2 2541 2683 7.0E-38
sp|Q969T4|UB2E3_HUMAN Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens GN=UBE2E3 PE=1 SV=1 2541 2683 7.0E-38
sp|Q2T9X7|UB2E3_BOVIN Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus GN=UBE2E3 PE=2 SV=1 2541 2683 7.0E-38
sp|Q91W82|UB2E2_MOUSE Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus GN=Ube2e2 PE=2 SV=1 2532 2683 7.0E-38
sp|Q96LR5|UB2E2_HUMAN Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens GN=UBE2E2 PE=1 SV=1 2532 2683 7.0E-38
sp|Q3ZCF7|UB2D3_BOVIN Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1 2541 2683 2.0E-37
sp|Q7ZY08|UBE2T_XENLA Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1 2542 2683 3.0E-37
sp|Q9CQ37|UBE2T_MOUSE Ubiquitin-conjugating enzyme E2 T OS=Mus musculus GN=Ube2t PE=1 SV=1 2542 2683 5.0E-37
sp|D3ZDK2|UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus GN=Ube2d1 PE=1 SV=1 2541 2683 5.0E-37
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1 2541 2683 5.0E-37
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1 2541 2683 5.0E-37
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1 2541 2683 5.0E-37
sp|P15732|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC5 PE=1 SV=1 2537 2683 6.0E-37
sp|Q9NPD8|UBE2T_HUMAN Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens GN=UBE2T PE=1 SV=1 2542 2683 6.0E-37
sp|P25867|UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=2 SV=1 2541 2683 2.0E-36
sp|Q9SLE4|UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1 2541 2683 2.0E-36
sp|P15731|UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC4 PE=1 SV=1 2537 2683 3.0E-36
sp|Q32LD2|UBE2T_BOVIN Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN=UBE2T PE=2 SV=2 2542 2683 4.0E-36
sp|P43102|UBC4_CANAX Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1 2537 2683 4.0E-36
sp|P35132|UBC9_ARATH SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1 2541 2683 9.0E-36
sp|P35131|UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1 2541 2683 1.0E-35
sp|P63149|UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1 2537 2673 1.0E-35
sp|P63148|UBE2B_RABIT Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1 2537 2673 1.0E-35
sp|P63147|UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1 2537 2673 1.0E-35
sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1 2537 2673 1.0E-35
sp|Q32P99|UBE2B_BOVIN Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1 2537 2673 1.0E-35
sp|P35133|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1 2541 2683 1.0E-35
sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=1 SV=1 2537 2673 1.0E-35
sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=1 SV=2 2537 2673 1.0E-35
sp|P35135|UBC4_SOLLC Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1 2541 2683 2.0E-35
sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1 2537 2677 2.0E-35
sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=1 SV=2 2541 2683 3.0E-35
sp|Q8S920|UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica GN=UBC5A PE=2 SV=1 2541 2683 3.0E-35
sp|Q94F47|UBC28_ARATH Ubiquitin-conjugating enzyme E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1 2541 2683 3.0E-35
sp|Q4PFA5|UBC2_USTMA Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UBC2 PE=3 SV=1 2537 2673 9.0E-35
sp|Q8S919|UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica GN=UBC5B PE=2 SV=1 2541 2683 2.0E-34
sp|Q9FKT3|UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1 2541 2683 2.0E-34
sp|Q9FI61|UBC27_ARATH Ubiquitin-conjugating enzyme E2 27 OS=Arabidopsis thaliana GN=UBC27 PE=2 SV=1 2557 2683 2.0E-34
sp|P21734|UBC1_YEAST Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC1 PE=1 SV=1 2537 2684 2.0E-34
sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=Ubc6 PE=2 SV=2 2537 2673 3.0E-34
sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1 2537 2677 1.0E-33
sp|P51965|UB2E1_HUMAN Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens GN=UBE2E1 PE=1 SV=1 2541 2683 2.0E-33
sp|P52482|UB2E1_MOUSE Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=1 SV=1 2541 2683 2.0E-33
sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1 2537 2679 2.0E-33
sp|P0CS16|UBC2_CRYNJ Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBC2 PE=3 SV=1 2541 2673 3.0E-33
sp|P0CS17|UBC2_CRYNB Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UBC2 PE=3 SV=1 2541 2673 3.0E-33
sp|P42745|UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1 2537 2677 4.0E-33
sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1 2541 2673 3.0E-32
sp|P42746|UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1 2541 2673 4.0E-32
sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-8 PE=3 SV=4 2541 2677 7.0E-32
sp|P78717|UBC2_NECHA Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1 2541 2677 8.0E-32
sp|Q08BH7|UBE2T_DANRE Ubiquitin-conjugating enzyme E2 T OS=Danio rerio GN=ube2t PE=2 SV=1 2537 2683 1.0E-31
sp|O74810|UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc1 PE=3 SV=2 2541 2684 1.0E-31
sp|Q4WLA7|UBC2_ASPFU Ubiquitin-conjugating enzyme E2 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ubc2 PE=3 SV=1 2541 2677 1.0E-31
sp|Q96UP5|UBC2_EMENI Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsJ PE=3 SV=1 2541 2677 3.0E-31
sp|P23566|UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp6 PE=1 SV=3 2541 2677 3.0E-31
sp|Q58FS2|UBC2_TRIHA Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1 2541 2677 6.0E-31
sp|Q553F3|UBC2_DICDI Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2 2541 2677 7.0E-31
sp|Q9LJD7|COP10_ARATH Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana GN=COP10 PE=1 SV=1 2541 2683 1.0E-30
sp|Q4R9D1|UBE2C_MACFA Ubiquitin-conjugating enzyme E2 C OS=Macaca fascicularis GN=UBE2C PE=2 SV=1 2541 2665 2.0E-30
sp|Q32PA5|UBE2C_BOVIN Ubiquitin-conjugating enzyme E2 C OS=Bos taurus GN=UBE2C PE=2 SV=1 2541 2665 3.0E-30
sp|Q94490|UBCB_DICDI Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum GN=ubcB PE=1 SV=1 2537 2683 3.0E-30
sp|Q9D1C1|UBE2C_MOUSE Ubiquitin-conjugating enzyme E2 C OS=Mus musculus GN=Ube2c PE=1 SV=1 2541 2665 4.0E-30
sp|O00762|UBE2C_HUMAN Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens GN=UBE2C PE=1 SV=1 2541 2665 8.0E-30
sp|B5DFI8|UBE2S_RAT Ubiquitin-conjugating enzyme E2 S OS=Rattus norvegicus GN=Ube2s PE=2 SV=1 2535 2684 9.0E-30
sp|Q6C093|UBC2_YARLI Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC2 PE=3 SV=1 2541 2681 1.0E-29
sp|Q75EB8|UBC2_ASHGO Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC2 PE=3 SV=1 2537 2676 2.0E-29
sp|P06104|UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD6 PE=1 SV=1 2537 2676 2.0E-29
sp|Q9C9Y7|UBC12_ARATH Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1 2541 2683 2.0E-29
sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBC2 PE=2 SV=1 2537 2677 3.0E-29
sp|P52484|UBC21_CAEEL Probable ubiquitin-conjugating enzyme E2 21 OS=Caenorhabditis elegans GN=ubc-21 PE=3 SV=3 2557 2683 5.0E-29
sp|Q6CUD9|UBC2_KLULA Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC2 PE=3 SV=1 2537 2676 5.0E-29
sp|Q6FR76|UBC2_CANGA Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC2 PE=3 SV=1 2537 2676 8.0E-29
sp|Q941B6|UBC37_ARATH Probable ubiquitin-conjugating enzyme E2 37 OS=Arabidopsis thaliana GN=UBC37 PE=2 SV=2 2539 2683 1.0E-28
sp|Q6BU36|UBC2_DEBHA Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC2 PE=3 SV=1 2537 2677 1.0E-28
sp|Q95044|UBE2C_SPISO Ubiquitin-conjugating enzyme E2 C OS=Spisula solidissima GN=UBE2C PE=1 SV=1 2538 2677 3.0E-28
sp|Q8L7T3|UBC20_ARATH Ubiquitin-conjugating enzyme E2 20 OS=Arabidopsis thaliana GN=UBC20 PE=2 SV=1 2538 2676 8.0E-28
sp|Q54XS6|UBE2C_DICDI Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1 2538 2681 1.0E-27
sp|O00103|UBC11_SCHPO Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc11 PE=3 SV=1 2538 2674 2.0E-27
sp|P56616|UBE2C_XENLA Ubiquitin-conjugating enzyme E2 C OS=Xenopus laevis GN=ube2c PE=1 SV=1 2538 2656 3.0E-27
sp|A7SE05|UBE2S_NEMVE Ubiquitin-conjugating enzyme E2 S OS=Nematostella vectensis GN=v1g237158 PE=3 SV=1 2532 2683 1.0E-26
sp|Q16763|UBE2S_HUMAN Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens GN=UBE2S PE=1 SV=2 2535 2684 1.0E-26
sp|Q921J4|UBE2S_MOUSE Ubiquitin-conjugating enzyme E2 S OS=Mus musculus GN=Ube2s PE=1 SV=1 2535 2684 1.0E-26
sp|A1L3K1|UB2SA_XENLA Ubiquitin-conjugating enzyme E2 S-A OS=Xenopus laevis GN=ube2s-a PE=2 SV=1 2535 2684 1.0E-26
sp|P52492|UBC11_YEAST Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC11 PE=1 SV=1 2534 2673 4.0E-26
sp|Q9LJZ5|UBC19_ARATH Ubiquitin-conjugating enzyme E2 19 OS=Arabidopsis thaliana GN=UBC19 PE=1 SV=1 2538 2676 5.0E-26
sp|Q1RML1|UBE2S_BOVIN Ubiquitin-conjugating enzyme E2 S OS=Bos taurus GN=UBE2S PE=2 SV=2 2535 2682 6.0E-26
sp|Q8AVU2|UB2SB_XENLA Ubiquitin-conjugating enzyme E2 S-B OS=Xenopus laevis GN=ube2s-b PE=2 SV=1 2541 2683 7.0E-26
sp|Q28F89|UBE2S_XENTR Ubiquitin-conjugating enzyme E2 S OS=Xenopus tropicalis GN=ube2s PE=2 SV=1 2535 2683 9.0E-26
sp|Q76EZ2|UB2SC_XENLA Ubiquitin-conjugating enzyme E2 S-C OS=Xenopus laevis GN=ube2s-c PE=2 SV=1 2541 2683 1.0E-25
sp|C1C3R6|UBE2S_LITCT Ubiquitin-conjugating enzyme E2 S OS=Lithobates catesbeiana GN=ube2s PE=2 SV=1 2535 2683 2.0E-25
sp|P61087|UBE2K_MOUSE Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=1 SV=3 2541 2684 3.0E-25
sp|P61086|UBE2K_HUMAN Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens GN=UBE2K PE=1 SV=3 2541 2684 3.0E-25
sp|P61085|UBE2K_BOVIN Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN=UBE2K PE=1 SV=3 2541 2684 3.0E-25
sp|Q9UTN8|UBC14_SCHPO Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc14 PE=3 SV=1 2543 2683 5.0E-25
sp|Q9C8X7|UBC31_ARATH Probable ubiquitin-conjugating enzyme E2 31 OS=Arabidopsis thaliana GN=UBC31 PE=2 SV=1 2563 2683 1.0E-24
sp|Q54I43|UBE2S_DICDI Ubiquitin-conjugating enzyme E2 S OS=Dictyostelium discoideum GN=ube2s PE=3 SV=1 2541 2684 3.0E-24
sp|P52486|UBCD4_DROME Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophila melanogaster GN=Ubc4 PE=1 SV=2 2533 2684 7.0E-24
sp|Q9FF66|UBC22_ARATH Ubiquitin-conjugating enzyme E2 22 OS=Arabidopsis thaliana GN=UBC22 PE=1 SV=1 2541 2683 8.0E-24
sp|Q9VTY6|UBE2C_DROME Ubiquitin-conjugating enzyme E2 C OS=Drosophila melanogaster GN=vih PE=1 SV=1 2538 2669 1.0E-23
sp|Q4V908|UBE2S_DANRE Ubiquitin-conjugating enzyme E2 S OS=Danio rerio GN=ube2s PE=2 SV=1 2535 2683 1.0E-23
sp|C3Z724|UBE2S_BRAFL Ubiquitin-conjugating enzyme E2 S OS=Branchiostoma floridae GN=BRAFLDRAFT_259979 PE=3 SV=1 2533 2683 2.0E-23
sp|Q86IZ3|UBCX_DICDI Ubiquitin-conjugating enzyme E2 pex4 OS=Dictyostelium discoideum GN=pex4 PE=3 SV=1 2539 2683 3.0E-23
sp|Q9VX25|UBE2S_DROME Ubiquitin-conjugating enzyme E2 S OS=Drosophila melanogaster GN=CG8188 PE=1 SV=2 2541 2683 5.0E-23
sp|Q8LGF7|PEX4_ARATH Protein PEROXIN-4 OS=Arabidopsis thaliana GN=PEX4 PE=1 SV=1 2545 2659 5.0E-23
sp|B4R6G1|UBE2S_DROSI Ubiquitin-conjugating enzyme E2 S OS=Drosophila simulans GN=GD17343 PE=3 SV=1 2541 2683 6.0E-23
sp|B4IF39|UBE2S_DROSE Ubiquitin-conjugating enzyme E2 S OS=Drosophila sechellia GN=GM13299 PE=3 SV=1 2541 2683 6.0E-23
sp|B4L7V4|UBE2S_DROMO Ubiquitin-conjugating enzyme E2 S OS=Drosophila mojavensis GN=GI11085 PE=3 SV=1 2541 2683 1.0E-22
sp|B4JKB7|UBE2S_DROGR Ubiquitin-conjugating enzyme E2 S OS=Drosophila grimshawi GN=GH12079 PE=3 SV=1 2541 2683 1.0E-22
sp|B4MA02|UBE2S_DROVI Ubiquitin-conjugating enzyme E2 S OS=Drosophila virilis GN=GJ15767 PE=3 SV=1 2541 2683 2.0E-22
sp|B4Q2J2|UBE2S_DROYA Ubiquitin-conjugating enzyme E2 S OS=Drosophila yakuba GN=GE15576 PE=3 SV=1 2541 2683 2.0E-22
sp|B3NWW9|UBE2S_DROER Ubiquitin-conjugating enzyme E2 S OS=Drosophila erecta GN=GG18165 PE=3 SV=1 2541 2683 2.0E-22
sp|B5DKM4|UBE2S_DROPS Ubiquitin-conjugating enzyme E2 S OS=Drosophila pseudoobscura pseudoobscura GN=GA22810 PE=3 SV=1 2541 2683 3.0E-22
sp|B4H9W2|UBE2S_DROPE Ubiquitin-conjugating enzyme E2 S OS=Drosophila persimilis GN=GL16001 PE=3 SV=1 2541 2683 3.0E-22
sp|B3MQV3|UBE2S_DROAN Ubiquitin-conjugating enzyme E2 S OS=Drosophila ananassae GN=GF21161 PE=3 SV=1 2541 2683 3.0E-22
sp|O00102|UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc7 PE=2 SV=2 2541 2676 6.0E-22
sp|B4N208|UBE2S_DROWI Ubiquitin-conjugating enzyme E2 S OS=Drosophila willistoni GN=GK16201 PE=3 SV=1 2541 2683 6.0E-22
sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=UBC PE=2 SV=1 2543 2666 2.0E-21
sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=UBC PE=2 SV=1 2543 2666 4.0E-21
sp|P68037|UB2L3_MOUSE Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus GN=Ube2l3 PE=1 SV=1 2577 2683 2.0E-20
sp|P68036|UB2L3_HUMAN Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens GN=UBE2L3 PE=1 SV=1 2577 2683 2.0E-20
sp|Q3MHP1|UB2L3_BOVIN Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus GN=UBE2L3 PE=2 SV=1 2577 2683 2.0E-20
sp|Q5R5I4|UB2L3_PONAB Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii GN=UBE2L3 PE=2 SV=1 2577 2683 2.0E-20
sp|P0C8G5|UBC_ASFWA Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=UBC PE=2 SV=1 2543 2666 2.0E-19
sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3 2545 2667 2.0E-19
sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=1 SV=3 2545 2667 2.0E-19
sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3 2545 2667 2.0E-19
sp|Q02159|UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC7 PE=1 SV=1 2541 2673 3.0E-19
sp|P0C8G3|UBC_ASFK5 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=UBC PE=2 SV=1 2543 2666 3.0E-19
sp|Q4R5Y8|UB2G1_MACFA Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1 2545 2667 3.0E-19
sp|P0C8G4|UBC_ASFP4 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=UBC PE=2 SV=1 2541 2665 4.0E-19
sp|Q17QG5|UB2G2_BOVIN Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1 2541 2680 1.0E-18
sp|Q9P6I1|UBC16_SCHPO Ubiquitin-conjugating enzyme E2 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc16 PE=3 SV=2 2541 2671 1.0E-18
sp|Q5RF84|UB2G2_PONAB Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1 2541 2680 2.0E-18
sp|P60605|UB2G2_MOUSE Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1 2541 2680 2.0E-18
sp|P60604|UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1 2541 2680 2.0E-18
sp|O60015|UBCX_PICAN Ubiquitin-conjugating enzyme E2-21 kDa OS=Pichia angusta GN=PEX4 PE=3 SV=1 2558 2673 3.0E-18
sp|P34477|UBC7_CAEEL Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1 2554 2676 3.0E-18
sp|Q6C9W0|UBC12_YARLI NEDD8-conjugating enzyme UBC12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC12 PE=3 SV=1 2562 2673 6.0E-18
sp|P62257|UBE2H_MOUSE Ubiquitin-conjugating enzyme E2 H OS=Mus musculus GN=Ube2h PE=1 SV=1 2567 2683 1.0E-17
sp|P62256|UBE2H_HUMAN Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens GN=UBE2H PE=1 SV=1 2567 2683 1.0E-17
sp|Q32LN1|UBE2H_BOVIN Ubiquitin-conjugating enzyme E2 H OS=Bos taurus GN=UBE2H PE=2 SV=1 2567 2683 1.0E-17
sp|Q5UQC9|UBC1_MIMIV Probable ubiquitin-conjugating enzyme E2 L460 OS=Acanthamoeba polyphaga mimivirus GN=UBC PE=3 SV=1 2564 2683 2.0E-17
sp|P52487|UBC84_DROME Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophila melanogaster GN=Ubc84D PE=2 SV=2 2537 2683 2.0E-17
sp|Q6P8D9|UBC12_XENTR NEDD8-conjugating enzyme Ubc12 OS=Xenopus tropicalis GN=ube2m PE=2 SV=1 2542 2676 2.0E-17
sp|Q6DCZ9|UBC12_XENLA NEDD8-conjugating enzyme Ubc12 OS=Xenopus laevis GN=ube2m PE=2 SV=1 2542 2676 2.0E-17
sp|Q28CQ4|UBC9_XENTR SUMO-conjugating enzyme UBC9 OS=Xenopus tropicalis GN=ube2i PE=2 SV=1 2542 2683 3.0E-17
sp|P63282|UBC9_XENLA SUMO-conjugating enzyme UBC9 OS=Xenopus laevis GN=ube2i PE=1 SV=1 2542 2683 3.0E-17
sp|P63281|UBC9_RAT SUMO-conjugating enzyme UBC9 OS=Rattus norvegicus GN=Ube2i PE=1 SV=1 2542 2683 3.0E-17
sp|P63280|UBC9_MOUSE SUMO-conjugating enzyme UBC9 OS=Mus musculus GN=Ube2i PE=1 SV=1 2542 2683 3.0E-17
sp|Q2EF73|UBC9_ICTTR SUMO-conjugating enzyme UBC9 OS=Ictidomys tridecemlineatus GN=UBE2I PE=1 SV=1 2542 2683 3.0E-17
sp|P63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 OS=Homo sapiens GN=UBE2I PE=1 SV=1 2542 2683 3.0E-17
sp|P63283|UBC9_CHICK SUMO-conjugating enzyme UBC9 OS=Gallus gallus GN=UBE2I PE=1 SV=1 2542 2683 3.0E-17
sp|Q6NY82|UBE2F_DANRE NEDD8-conjugating enzyme UBE2F OS=Danio rerio GN=ube2f PE=2 SV=1 2543 2683 4.0E-17
sp|Q9SDY5|RCE1_ARATH NEDD8-conjugating enzyme Ubc12 OS=Arabidopsis thaliana GN=RCE1 PE=1 SV=1 2542 2669 4.0E-17
sp|P61082|UBC12_MOUSE NEDD8-conjugating enzyme Ubc12 OS=Mus musculus GN=Ube2m PE=1 SV=1 2565 2676 5.0E-17
sp|P61081|UBC12_HUMAN NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens GN=UBE2M PE=1 SV=1 2565 2676 5.0E-17
sp|A3KN22|UBC12_BOVIN NEDD8-conjugating enzyme Ubc12 OS=Bos taurus GN=UBE2M PE=2 SV=1 2565 2676 5.0E-17
sp|Q9VSF3|UBC12_DROME Nedd8-conjugating enzyme Ubc12 OS=Drosophila melanogaster GN=Ubc12 PE=1 SV=1 2562 2673 5.0E-17
sp|Q5M8Y2|UBE2F_XENTR NEDD8-conjugating enzyme UBE2F OS=Xenopus tropicalis GN=ube2f PE=2 SV=1 2543 2683 5.0E-17
sp|Q9DDJ0|UBC9B_DANRE SUMO-conjugating enzyme UBC9-B OS=Danio rerio GN=ube2ib PE=1 SV=1 2542 2683 7.0E-17
sp|O74549|UBC12_SCHPO NEDD8-conjugating enzyme ubc12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc12 PE=3 SV=1 2577 2674 7.0E-17
sp|Q9W6H5|UBC9A_DANRE SUMO-conjugating enzyme UBC9-A OS=Danio rerio GN=ube2ia PE=1 SV=1 2542 2683 7.0E-17
sp|P42750|UBC6_ARATH Ubiquitin-conjugating enzyme E2 6 OS=Arabidopsis thaliana GN=UBC6 PE=2 SV=2 2565 2683 7.0E-17
sp|Q6CSW8|UBC12_KLULA NEDD8-conjugating enzyme UBC12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC12 PE=3 SV=1 2564 2667 9.0E-17
sp|Q42541|UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1 2554 2676 9.0E-17
sp|P42747|UBC14_ARATH Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=1 SV=1 2554 2676 1.0E-16
sp|P28263|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC8 PE=1 SV=2 2565 2683 1.0E-16
sp|Q29503|UB2R2_RABIT Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1 2541 2680 1.0E-16
sp|Q6ZWZ2|UB2R2_MOUSE Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=1 SV=1 2541 2680 1.0E-16
sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1 2541 2680 1.0E-16
sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=1 SV=1 2554 2676 2.0E-16
sp|Q5ZKX6|UBE2F_CHICK NEDD8-conjugating enzyme UBE2F OS=Gallus gallus GN=UBE2F PE=2 SV=1 2541 2683 2.0E-16
sp|Q6IRC7|UBE2F_XENLA NEDD8-conjugating enzyme UBE2F OS=Xenopus laevis GN=ube2f PE=2 SV=1 2543 2683 3.0E-16
sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc15 PE=3 SV=1 2545 2667 3.0E-16
sp|P42748|UBC4_ARATH Ubiquitin-conjugating enzyme E2 4 OS=Arabidopsis thaliana GN=UBC4 PE=2 SV=2 2561 2683 5.0E-16
sp|Q54TI6|UBC12_DICDI NEDD8-conjugating enzyme Ubc12 OS=Dictyostelium discoideum GN=ube2m PE=3 SV=1 2570 2677 5.0E-16
sp|P42749|UBC5_ARATH Ubiquitin-conjugating enzyme E2 5 OS=Arabidopsis thaliana GN=UBC5 PE=2 SV=2 2565 2683 5.0E-16
sp|Q5U203|UBE2F_RAT NEDD8-conjugating enzyme UBE2F OS=Rattus norvegicus GN=Ube2f PE=2 SV=2 2541 2683 6.0E-16
sp|Q42551|SCE1_ARATH SUMO-conjugating enzyme SCE1 OS=Arabidopsis thaliana GN=SCE1 PE=1 SV=1 2566 2659 7.0E-16
sp|Q9CY34|UB2FA_MOUSE NEDD8-conjugating enzyme UBE2F OS=Mus musculus GN=Ube2f PE=1 SV=1 2541 2683 7.0E-16
sp|Q8CFI2|UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1 2538 2679 7.0E-16
sp|P52491|UBC12_YEAST NEDD8-conjugating enzyme UBC12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC12 PE=1 SV=1 2577 2676 7.0E-16
sp|P49427|UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2 2538 2679 8.0E-16
sp|Q969M7|UBE2F_HUMAN NEDD8-conjugating enzyme UBE2F OS=Homo sapiens GN=UBE2F PE=1 SV=1 2541 2683 8.0E-16
sp|Q6FVQ8|UBC12_CANGA NEDD8-conjugating enzyme UBC12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC12 PE=3 SV=1 2577 2662 9.0E-16
sp|Q9P7R4|UBC8_SCHPO Ubiquitin-conjugating enzyme E2 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc8 PE=3 SV=1 2565 2661 2.0E-15
sp|Q6Y1Z4|UBC9_PAGMA SUMO-conjugating enzyme UBC9 OS=Pagrus major GN=ube2i PE=2 SV=1 2542 2683 2.0E-15
sp|Q5UQ40|UBC4_MIMIV Probable bifunctional E2/E3 enzyme R795 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R795 PE=3 SV=1 2542 2666 2.0E-15
sp|Q9ZU75|UB12L_ARATH Probable NEDD8-conjugating enzyme Ubc12-like OS=Arabidopsis thaliana GN=RCE2 PE=2 SV=1 2542 2669 3.0E-15
sp|O14933|UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens GN=UBE2L6 PE=1 SV=4 2537 2679 4.0E-15
sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1 2564 2676 4.0E-15
sp|Q1RMW1|UBE2F_BOVIN NEDD8-conjugating enzyme UBE2F OS=Bos taurus GN=UBE2F PE=2 SV=1 2543 2683 5.0E-15
sp|P14682|UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC34 PE=1 SV=1 2549 2677 5.0E-15
sp|P40984|UBC9_SCHPO SUMO-conjugating enzyme ubc9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hus5 PE=1 SV=1 2542 2676 5.0E-15
sp|O09181|UBC9_MESAU SUMO-conjugating enzyme UBC9 OS=Mesocricetus auratus GN=UBE2I PE=2 SV=1 2542 2682 5.0E-15
sp|P29340|UBCX_YEAST Ubiquitin-conjugating enzyme E2-21 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX4 PE=1 SV=1 2525 2661 1.0E-14
sp|Q3UWQ3|UB2FB_MOUSE NEDD8-conjugating enzyme UBE2F-B OS=Mus musculus GN=Ube2fb PE=2 SV=1 2562 2683 2.0E-14
sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa OS=Triticum aestivum GN=UBC4 PE=1 SV=1 2565 2683 2.0E-14
sp|Q8SSK3|Y1A1_ENCCU Probable ubiquitin-conjugating enzyme E2 ECU01_1010 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_1010 PE=1 SV=1 2566 2677 3.0E-14
sp|A5PJC4|UB2L6_BOVIN Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Bos taurus GN=UBE2L6 PE=2 SV=1 2537 2683 6.0E-14
sp|Q95017|UBC9_CAEEL SUMO-conjugating enzyme UBC9 OS=Caenorhabditis elegans GN=ubc-9 PE=1 SV=1 2542 2684 1.0E-13
sp|P50623|UBC9_YEAST SUMO-conjugating enzyme UBC9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC9 PE=1 SV=1 2541 2673 3.0E-13
sp|Q4V8J2|UB2L6_RAT Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Rattus norvegicus GN=Ube2l6 PE=2 SV=1 2537 2684 6.0E-13
sp|Q55EY8|UBE2W_DICDI Probable ubiquitin-conjugating enzyme E2 W OS=Dictyostelium discoideum GN=ube2w PE=3 SV=1 2541 2649 9.0E-13
sp|Q9NGP4|UBC9_DICDI Sumo-conjugating enzyme ubc9 OS=Dictyostelium discoideum GN=ubc9 PE=3 SV=1 2542 2655 1.0E-12
sp|Q3UE37|UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus GN=Ube2z PE=1 SV=2 2496 2648 1.0E-12
sp|Q9H832|UBE2Z_HUMAN Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens GN=UBE2Z PE=1 SV=2 2496 2648 1.0E-12
sp|Q3B7D1|UBE2Z_RAT Ubiquitin-conjugating enzyme E2 Z OS=Rattus norvegicus GN=Ube2z PE=1 SV=2 2496 2648 1.0E-12
sp|Q9QZU9|UB2L6_MOUSE Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Mus musculus GN=Ube2l6 PE=1 SV=3 2537 2683 2.0E-12
sp|Q11076|UBC17_CAEEL Probable ubiquitin-conjugating enzyme protein 17 OS=Caenorhabditis elegans GN=ubc-17 PE=3 SV=3 2541 2652 2.0E-12
sp|Q74Z34|UBC6_ASHGO Ubiquitin-conjugating enzyme E2 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC6 PE=3 SV=1 2541 2648 3.0E-12
sp|Q6BYG4|UBC6_DEBHA Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC6 PE=3 SV=2 2541 2681 3.0E-12
sp|Q6CMG6|UBC6_KLULA Ubiquitin-conjugating enzyme E2 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC6 PE=3 SV=1 2541 2673 3.0E-12
sp|Q6DG60|UBE2Z_DANRE Ubiquitin-conjugating enzyme E2 Z OS=Danio rerio GN=ube2z PE=2 SV=2 2542 2648 4.0E-12
sp|Q66KB0|UBE2Z_XENTR Ubiquitin-conjugating enzyme E2 Z OS=Xenopus tropicalis GN=ube2z PE=2 SV=2 2491 2648 4.0E-12
sp|Q6PCF7|UBE2Z_XENLA Ubiquitin-conjugating enzyme E2 Z OS=Xenopus laevis GN=ube2z PE=2 SV=2 2542 2648 5.0E-12
sp|P33296|UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC6 PE=1 SV=1 2541 2649 9.0E-12
sp|Q75AF2|UBC12_ASHGO NEDD8-conjugating enzyme UBC12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC12 PE=3 SV=2 2582 2656 9.0E-12
sp|P42743|UBC15_ARATH Ubiquitin-conjugating enzyme 15 OS=Arabidopsis thaliana GN=UBC15 PE=2 SV=2 2542 2640 1.0E-11
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 2345 2486 1.0E-11
sp|Q1JPX4|UB2WB_DANRE Probable ubiquitin-conjugating enzyme E2 W-B OS=Danio rerio GN=ube2wb PE=2 SV=1 2538 2649 2.0E-11
sp|Q9Y385|UB2J1_HUMAN Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens GN=UBE2J1 PE=1 SV=2 2541 2647 2.0E-11
sp|Q9JJZ4|UB2J1_MOUSE Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus GN=Ube2j1 PE=1 SV=2 2541 2647 2.0E-11
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 2361 2455 2.0E-11
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 2361 2455 2.0E-11
sp|Q8VDW4|UBE2W_MOUSE Ubiquitin-conjugating enzyme E2 W OS=Mus musculus GN=Ube2w PE=1 SV=1 2538 2649 2.0E-11
sp|B5DEI4|UBE2W_RAT Ubiquitin-conjugating enzyme E2 W OS=Rattus norvegicus GN=Ube2w PE=2 SV=1 2538 2649 3.0E-11
sp|Q96B02|UBE2W_HUMAN Ubiquitin-conjugating enzyme E2 W OS=Homo sapiens GN=UBE2W PE=1 SV=1 2538 2649 3.0E-11
sp|A6H795|UBE2W_BOVIN Ubiquitin-conjugating enzyme E2 W OS=Bos taurus GN=UBE2W PE=2 SV=1 2538 2649 3.0E-11
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 2361 2455 3.0E-11
sp|Q95LM1|UBE2U_MACFA Ubiquitin-conjugating enzyme E2 U OS=Macaca fascicularis GN=UBE2U PE=2 SV=1 2557 2668 4.0E-11
sp|Q9FWT2|UBC16_ARATH Probable ubiquitin-conjugating enzyme E2 16 OS=Arabidopsis thaliana GN=UBC16 PE=2 SV=1 2542 2640 5.0E-11
sp|Q5VVX9|UBE2U_HUMAN Ubiquitin-conjugating enzyme E2 U OS=Homo sapiens GN=UBE2U PE=1 SV=1 2557 2668 5.0E-11
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 2361 2455 7.0E-11
sp|Q9ZQF9|MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana GN=MBR1 PE=1 SV=1 2362 2456 9.0E-11
sp|Q4VBH4|UB2WA_DANRE Probable ubiquitin-conjugating enzyme E2 W-A OS=Danio rerio GN=ube2wa PE=2 SV=2 2538 2649 1.0E-10
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 2359 2455 1.0E-10
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 2359 2455 1.0E-10
sp|Q28FC1|UBE2W_XENTR Ubiquitin-conjugating enzyme E2 W OS=Xenopus tropicalis GN=ube2w PE=2 SV=1 2538 2649 1.0E-10
sp|Q9FMM0|UBC18_ARATH Probable ubiquitin-conjugating enzyme E2 18 OS=Arabidopsis thaliana GN=UBC18 PE=2 SV=1 2542 2640 2.0E-10
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 2365 2453 3.0E-10
sp|Q6FQK7|UBC6_CANGA Ubiquitin-conjugating enzyme E2 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC6 PE=3 SV=1 2541 2673 3.0E-10
sp|P87237|YC0C_SCHPO Uncharacterized RING finger protein C4G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.12c PE=3 SV=1 2368 2453 4.0E-10
sp|O23239|UBC17_ARATH Probable ubiquitin-conjugating enzyme E2 17 OS=Arabidopsis thaliana GN=UBC17 PE=2 SV=1 2542 2640 5.0E-10
sp|Q2TA03|UB2J2_BOVIN Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus GN=UBE2J2 PE=2 SV=1 2541 2652 8.0E-10
sp|O49500|MBR2_ARATH E3 ubiquitin-protein ligase MBR2 OS=Arabidopsis thaliana GN=MBR2 PE=1 SV=1 2362 2454 8.0E-10
sp|Q9LSP7|UBC32_ARATH Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana GN=UBC32 PE=2 SV=1 2541 2651 9.0E-10
sp|Q8N2K1|UB2J2_HUMAN Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens GN=UBE2J2 PE=1 SV=3 2541 2652 1.0E-09
sp|P49428|UBCX_PICPA Ubiquitin-conjugating enzyme E2-24 kDa OS=Komagataella pastoris GN=PEX4 PE=1 SV=1 2537 2671 2.0E-09
sp|Q9P7E1|YOF7_SCHPO Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.07 PE=1 SV=1 2367 2455 7.0E-09
sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens GN=UBE2O PE=1 SV=3 2545 2652 1.0E-08
sp|Q9XVK5|UBC12_CAEEL NEDD8-conjugating enzyme ubc-12 OS=Caenorhabditis elegans GN=ubc-12 PE=2 SV=1 2577 2682 1.0E-08
sp|Q6ZPJ3|UBE2O_MOUSE (E3-independent) E2 ubiquitin-conjugating enzyme UBE2O OS=Mus musculus GN=Ube2o PE=1 SV=3 2545 2652 1.0E-08
sp|Q6P073|UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus GN=Ube2j2 PE=1 SV=1 2541 2652 1.0E-08
sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 2354 2456 2.0E-08
sp|O88738|BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus GN=Birc6 PE=1 SV=2 2564 2652 2.0E-08
sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 2564 2652 2.0E-08
sp|O42646|UBC6_SCHPO Ubiquitin-conjugating enzyme E2 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc6 PE=2 SV=1 2541 2649 3.0E-08
sp|Q9SLC3|ATL41_ARATH E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana GN=ATL41 PE=1 SV=1 2411 2459 3.0E-08
sp|Q9LUQ5|UBC25_ARATH Probable ubiquitin-conjugating enzyme E2 25 OS=Arabidopsis thaliana GN=UBC25 PE=2 SV=1 2541 2647 1.0E-07
sp|Q9M313|ATL68_ARATH RING-H2 finger protein ATL68 OS=Arabidopsis thaliana GN=ATL68 PE=2 SV=1 2405 2462 2.0E-07
sp|F4HPP7|UBC39_ARATH Putative ubiquitin-conjugating enzyme E2 39 OS=Arabidopsis thaliana GN=UBC39 PE=3 SV=1 2541 2667 6.0E-07
sp|Q9ZVX1|UBC23_ARATH Probable ubiquitin-conjugating enzyme E2 23 OS=Arabidopsis thaliana GN=UBC23 PE=1 SV=1 2541 2652 7.0E-07
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 2391 2459 1.0E-06
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 2387 2458 1.0E-06
sp|Q9SLC4|ATL40_ARATH RING-H2 finger protein ATL40 OS=Arabidopsis thaliana GN=ATL40 PE=2 SV=1 2411 2458 1.0E-06
sp|Q570X5|ATL58_ARATH RING-H2 finger protein ATL58 OS=Arabidopsis thaliana GN=ATL58 PE=2 SV=1 2410 2472 2.0E-06
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 2383 2495 2.0E-06
sp|Q6NKR1|ATL28_ARATH RING-H2 finger protein ATL28 OS=Arabidopsis thaliana GN=ATL28 PE=2 SV=1 2390 2458 2.0E-06
sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 2367 2457 2.0E-06
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 2383 2458 2.0E-06
sp|O80927|ATL33_ARATH RING-H2 finger protein ATL33 OS=Arabidopsis thaliana GN=ATL33 PE=2 SV=2 2404 2462 2.0E-06
sp|Q8GY87|UBC26_ARATH Probable ubiquitin-conjugating enzyme E2 26 OS=Arabidopsis thaliana GN=UBC26 PE=2 SV=2 2541 2652 3.0E-06
sp|O49691|ATL29_ARATH RING-H2 finger protein ATL29 OS=Arabidopsis thaliana GN=ATL29 PE=3 SV=1 2385 2457 3.0E-06
sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 2367 2457 3.0E-06
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 2374 2456 4.0E-06
sp|Q9LQM2|ATL81_ARATH RING-H2 finger protein ATL81 OS=Arabidopsis thaliana GN=ATL81 PE=2 SV=1 2398 2457 5.0E-06
sp|Q8N7C7|RN148_HUMAN RING finger protein 148 OS=Homo sapiens GN=RNF148 PE=2 SV=2 2408 2456 6.0E-06
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 2409 2514 7.0E-06
sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 2390 2457 8.0E-06
sp|O82353|ATL67_ARATH RING-H2 finger protein ATL67 OS=Arabidopsis thaliana GN=ATL67 PE=2 SV=1 2411 2453 8.0E-06
sp|Q9LSW9|ATL16_ARATH RING-H2 finger protein ATL16 OS=Arabidopsis thaliana GN=ATL16 PE=2 SV=1 2380 2456 9.0E-06
sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 2409 2458 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|030020
MPSATDDGRGLHLRLTLSSGSMASSTGGPTSFKRSLEELFGGAESDGDEERSSTGGAGGMMVGGGVGNGGGSSNG
RNKRQRSESAEQPLQNSASSSSSSSSAANGRGLSLPPRLPTPRLDVHMSDIPLLGSNEGLEFSSPHRRSQHRLQH
RRQSSSSRSLSPLVPSTPASVSTSTSPQSSIFVTTQQTNLTLSAIHNTSTSAHATATAIPTLGLGPPSISASPSA
VSSSSLPSSSSSSLSSVPSSLSRSDRSSSPSLILPLPISRSAQTPPTATSIAGSLPLLSPTTATEIDTGPGPGSI
INETEASPSTATAGGVATFLGPEERFRATMQRYNVFEHEIAALRRSVSPPGLSRSLAVAGMGEQQQQQQRTASPP
RLPPLELSTLRDEGDDVDSDEGEDQDQVRPLGSLRHEDVASIPSTVSASSERLSASSALHLPDRNAQRNNPESFL
ALSAAAEVSPLPLDEDIDELEDDDADLLRSNHHHHHHQHQPISAPLLVHGRRHRPVRAAVRDAPPRIELPNAVWS
SLDIVSEATLPTSARNITTSTTTTTIHDPAIVELDGSGEDDDESDAPEDDHGNDLVYPRFRDHLDSALEALRSPS
SPLVPGLVPSGIESSIALTSIPNNDNEPPATIVLNDSGDYQPNHTSPSPPPVIRSALSLSSPSFSNDVVIAPVRD
LQTQGTSNPALFSSPLSQSAPTANANMARRFGRPPTLPPILTEPTYLNYTNSSSGHGDSRYVYHRSMIPPLSSSS
ASPRERDEQSTRIRRRRISIDNENDRNEDIEAGGQATTNSRGMLQRSSNLGEVELPSPSLSEFYDWLGSPNSPDP
DLLRDVVPTTRQDNSVGRPPGSSREVMRERERDGELENRRRSWEEDVLSGFMNTGVGLDLRLRQREREQQQQQEQ
EQPISLPPPLPLPARPTSERRLSMDTSIVGMDVDMESSEDLEARQRELELERLPWTLGSSITSSTTRTNQHSPRL
HLHRESRRFTPSVSMSRSRERLRLYNDIEVDDGWNPLHSTRHWYPESAPVALTSSSMSSLPTFSSSLFSSPSSPP
ISTNQSTGVHPPPPSTAATSSGSRPRLPNFLLPTSSSHRRGQNHLSPFSRHSSSSTTATITRETERERRRSSAES
NGSLPPSLELNLGPSSHSVFATSAAGGPRASGTAGEEVSGQYQHSSTTTPSSSSSSLTPFIQLFEPPTAVPPPSL
GQQAPLLSSQRENRQNQRQRNPTEIEVLDGDDEDMNDDMGVVSSDNQQRQPLEPLPHLPQYEDRERQRQQQQQQD
RYRSLTRIVGSDNSLVAENAAETRRLYARMDMDRRLHQHSLNISVPSARSWASVVEEEEGSRNIGVDEDVRYGAR
RVEVRRQGESTGVGEYSERQQRARVLASQIQHHRRQRADASGRQLRYEEPVSRRFTCHFPDLLDGIGMAPRVTNS
GGSGSTSSLNDRTSGPRIAPPPPRPRLHSIRQVPAPSENTGFGNVRGDDDNGHRSSRSRSQGGDNRNSNTNPLGP
SAATITNAPSHQMPPEEEWGTMFQLRSPGNHVDPGTVAATAQRPSITDSAARTSLDSVSSSDSSMTDSFTSSGAS
SFSASGPNVLPLRVPNRRMFLDTELPSPGLGGLFDTLGANTIPAIADSLTTVPRPTRNSTTNPPSAPSSVAAMAP
TSDHYSSNSSSGFLSSTTGRFTPSPVRTSDGDLDEDRVVADETARLHSLASRLGNMRDEMVSEMMNLWERPQGVE
SEMRMDIGEGEPRGRAQNIHRAPTAHRTSVSDFRRPGPFPPPSSTAVAQRTRTEDLTFPSSPSANVGSTGRERRH
PGIDTSLFSPGIFRNSLEPYANSAREHTAQASSSVPSSSSLPAASRATPVPATSISSPTMSSGFLSPPTASHPPP
VSYMLASEQPPRNSLVPRQQPRRHYHHHHHHHHHHSLSGRTQSPPVIPPLSFENHSSENDAAAAAAGARARQRSD
VQEPLDSAANENEQMRQGYFSLLRRQQRDGIARRADETSIRDGERPSNVRSSASAAPSNSLSSSSPSSSPTPFER
SYLSWSQLERLLERSPERTEYRTSPGSSSRAAENRVRGNMEAMRVSIERQRRMRREAFDEQRRIAERNGDVLRWR
NENNNNNNPRPFHNGGSSGDAPTRNMATTDVPNTPSTIPDMLYDRMRQSRENIAQNESGSTTTTVGGNHNNENAG
SQRRRWYDVVQGNFRSVLPEEEDEDESEEDLYRETYPTPRRYRDPPLPNFGPRMPLPRFESRSQGVIERERENST
TRHRGPLTHSNPGNVGWIPQERVSPRARNVGGGQDTSGTSGSRDNGATAVAAAINHVNHVGRRLGERTMHRLRAG
AMAGATNGPGGNGVAGMMSFGRLGRRIGDLGDYLNDDEFDASYESLLSLQEALGDVRPRSTPEAVLKKLKTGKYK
EWVEQGGEIRCPICLEDYNPEDVLLKSGNCKHWMHRACLEEWFKSANTCPVCRTEVEPRSQSRMRCRRPVASARR
NPGSGNSGDRGEGGSGSAGDPGLDPSLDPNGSGPDSNSGSGRSGDSADFLENLDEFTAGNCMSLPKRIIKETERL
VADPAPGISAEPHEDNLRYFNVTIEGPGGSPFENGKFKLELFLPEEYPMAPPKVRFLTKIYHPNIDKLGRICLDI
LKDKWSPALQIRTVLLSIQALLSAPNPDDPLATDVAKHYKENEKDAQRVSREWTQAYAA*
Coding >AgabiH97|030020
ATGCCTTCTGCTACGGACGATGGTAGGGGATTGCATTTGAGGCTTACACTGTCGTCGGGTTCCATGGCTTCTTCC
ACTGGAGGTCCAACGTCGTTCAAGAGGAGCTTAGAGGAGCTGTTTGGAGGAGCTGAGAGTGATGGGGACGAGGAG
AGGAGTTCAACAGGTGGGGCGGGGGGGATGATGGTTGGTGGTGGCGTTGGGAATGGGGGAGGAAGCAGTAATGGG
CGCAACAAAAGACAGCGCAGTGAAAGCGCTGAGCAGCCACTACAAAACTCGGCCTCGTCGTCGTCGTCTTCGTCG
TCTGCAGCTAATGGACGAGGCCTTTCCCTACCGCCGAGATTGCCTACGCCGAGACTGGACGTTCATATGTCAGAT
ATTCCTCTCTTAGGTTCCAATGAGGGACTCGAATTTTCCTCGCCTCACCGTCGTTCGCAACATCGACTGCAACAT
CGACGACAGTCATCCTCTTCTAGATCCTTATCTCCACTAGTACCCTCCACACCTGCATCCGTATCGACATCGACA
TCTCCTCAATCATCCATTTTTGTAACAACACAACAAACAAACTTGACTTTATCCGCAATCCACAATACTAGTACT
AGCGCGCATGCCACTGCAACGGCAATACCAACTTTGGGCTTAGGACCACCATCGATATCGGCCTCACCGTCCGCT
GTATCTTCATCTTCATTACCCTCATCGTCATCATCGTCATTATCATCTGTGCCGTCGTCTCTGAGCAGATCAGAC
AGGTCTTCTTCGCCGAGTCTTATTCTACCTCTACCCATTTCTCGATCAGCTCAGACTCCTCCCACTGCAACAAGT
ATAGCTGGGAGCTTGCCTTTGCTTTCACCAACAACCGCAACTGAAATTGATACCGGTCCTGGTCCTGGCTCTATT
ATTAATGAGACAGAAGCTTCTCCTAGTACCGCCACTGCTGGAGGTGTGGCTACTTTTCTAGGACCAGAGGAGAGG
TTTAGAGCCACGATGCAGAGGTATAATGTATTTGAGCATGAGATTGCCGCGTTGAGAAGGTCTGTTAGTCCTCCT
GGTTTATCGAGAAGTTTGGCGGTTGCTGGGATGGGGGAACAGCAGCAACAGCAGCAGCGAACTGCGTCACCTCCG
AGGTTACCTCCGTTGGAGTTGAGTACTTTGAGGGATGAAGGTGACGATGTTGACAGTGATGAAGGAGAGGATCAG
GATCAAGTCCGGCCTCTTGGCTCGTTGAGGCATGAAGATGTAGCATCTATTCCTTCGACCGTTTCAGCAAGTAGT
GAACGTTTATCAGCGTCTTCGGCACTACACTTACCAGATAGGAATGCCCAGCGAAACAATCCCGAATCCTTCCTT
GCTTTGTCTGCAGCTGCGGAAGTTTCACCACTACCTCTTGATGAAGATATTGATGAGCTTGAAGATGATGATGCA
GATTTGTTAAGGAGTAATCACCATCACCATCACCATCAACATCAACCAATCTCCGCTCCTCTTCTAGTTCATGGA
CGTAGACACAGACCTGTTCGAGCTGCAGTACGCGATGCTCCACCCAGAATCGAACTACCAAATGCTGTGTGGTCG
TCTTTGGATATTGTTTCTGAAGCCACTCTTCCAACTTCCGCAAGAAATATCACTACCTCCACGACGACGACGACG
ATTCATGATCCAGCCATAGTAGAGTTGGATGGCTCAGGAGAGGATGACGACGAGAGTGATGCTCCTGAAGATGAT
CATGGTAACGATCTTGTTTATCCGCGTTTCAGAGATCACCTCGACTCTGCACTTGAAGCACTTCGATCACCTTCT
TCGCCACTCGTTCCAGGACTCGTACCTAGCGGTATAGAGTCTTCAATTGCTCTAACATCGATCCCCAACAATGAT
AATGAACCGCCCGCTACCATTGTTCTAAATGATTCTGGAGATTATCAGCCTAATCATACATCACCTTCTCCTCCA
CCTGTCATTCGTTCTGCTTTGTCTTTGTCCTCTCCATCCTTCTCGAACGACGTTGTGATTGCGCCAGTACGGGAT
TTACAAACACAGGGTACATCAAATCCTGCTTTATTTTCTTCTCCATTGTCGCAATCGGCACCAACGGCGAATGCG
AATATGGCTCGCAGATTTGGTCGACCTCCTACTTTACCTCCCATACTCACAGAGCCTACCTACTTGAATTATACA
AATTCCAGTTCTGGACATGGGGATAGCAGATACGTTTATCACCGATCAATGATACCGCCCTTGTCATCGTCGTCG
GCATCACCTCGAGAGCGGGACGAACAGTCAACAAGGATAAGAAGAAGGAGAATTTCAATCGACAACGAGAATGAC
CGTAACGAAGATATCGAAGCCGGTGGACAAGCTACTACAAATTCGAGAGGAATGCTTCAGAGATCTTCGAATTTG
GGTGAGGTGGAATTACCTTCACCTTCGTTAAGCGAGTTTTACGATTGGCTGGGAAGTCCTAATAGCCCTGATCCG
GATCTTTTGAGAGACGTTGTTCCGACGACGAGACAAGATAATTCTGTTGGACGTCCGCCTGGGTCGTCTAGGGAG
GTAATGAGAGAGAGGGAGAGGGATGGAGAGCTGGAGAATAGGAGGAGGAGTTGGGAGGAAGATGTTTTATCTGGA
TTCATGAATACTGGAGTTGGGCTTGATTTGAGGCTCCGACAAAGGGAAAGGGAGCAGCAGCAGCAGCAAGAACAA
GAACAACCAATCTCATTACCCCCACCACTTCCTCTCCCCGCAAGACCGACTTCGGAAAGGAGGCTCTCTATGGAC
ACTAGCATTGTTGGAATGGACGTTGATATGGAATCTTCCGAAGATTTGGAGGCCAGGCAAAGAGAATTGGAGCTA
GAAAGGTTACCTTGGACACTGGGGTCGTCCATCACATCGTCGACGACGAGAACGAATCAACACTCTCCTCGACTT
CATCTCCATCGCGAATCGAGACGTTTTACACCATCAGTCTCGATGAGTCGAAGCAGAGAAAGATTGAGGTTGTAC
AATGACATCGAAGTTGATGATGGATGGAATCCATTACATTCGACTCGTCATTGGTATCCTGAATCTGCTCCAGTT
GCATTAACTTCATCATCAATGTCTTCACTACCAACATTTTCTTCGAGTTTATTTTCCTCTCCTTCGTCTCCGCCA
ATATCCACCAATCAATCTACTGGAGTCCATCCTCCCCCTCCTTCCACTGCGGCAACATCGTCGGGTTCAAGACCC
AGATTACCTAATTTCTTGCTACCAACGTCATCGTCGCATAGAAGAGGGCAAAATCATTTGTCTCCTTTTTCGAGG
CACTCTTCTTCTAGTACTACTGCTACTATTACAAGGGAAACAGAAAGGGAAAGAAGACGAAGTTCTGCGGAAAGC
AATGGTTCTTTGCCACCCAGCCTTGAACTCAATCTCGGTCCATCGAGTCATTCCGTTTTTGCGACCAGTGCTGCT
GGTGGTCCTCGTGCAAGTGGTACCGCTGGTGAAGAAGTCTCAGGCCAATACCAACACTCTTCGACGACAACACCG
TCATCGTCATCATCATCTTTGACACCTTTCATACAACTATTCGAACCCCCCACTGCTGTCCCCCCGCCTTCGTTG
GGCCAACAAGCTCCTCTATTATCATCTCAACGAGAAAACCGTCAAAATCAGAGGCAAAGAAACCCGACGGAAATT
GAGGTGCTTGATGGTGACGATGAAGATATGAATGACGATATGGGTGTGGTCTCGAGTGATAATCAACAAAGACAA
CCACTAGAACCATTACCCCATTTACCACAATATGAAGATCGAGAGCGGCAGCGGCAACAACAACAACAACAGGAT
AGGTACAGGTCACTTACACGTATTGTGGGGTCTGATAATTCACTCGTGGCGGAAAATGCAGCTGAGACCAGGAGA
TTGTATGCGAGAATGGATATGGATAGGAGGTTGCATCAACATTCGTTAAATATATCAGTGCCTTCTGCGAGGTCT
TGGGCTTCTGTTGTTGAGGAGGAAGAGGGTTCGAGAAATATTGGTGTAGATGAAGATGTGAGGTACGGCGCGCGT
CGTGTGGAAGTTAGGAGACAGGGGGAGAGTACTGGCGTTGGAGAGTATAGTGAACGGCAGCAGCGAGCTCGGGTT
CTGGCTTCACAGATACAGCATCACCGACGTCAGCGTGCTGATGCCAGTGGTAGGCAGTTACGCTATGAAGAGCCT
GTGTCAAGGCGTTTTACGTGTCACTTTCCAGATTTGCTTGACGGTATTGGGATGGCTCCCAGAGTCACAAATAGC
GGTGGAAGCGGTAGTACTTCAAGTCTAAATGATCGCACATCTGGACCTCGTATTGCTCCACCCCCACCTCGACCT
AGGCTTCATTCCATCCGCCAGGTCCCAGCCCCTTCCGAAAATACTGGGTTTGGCAATGTTCGTGGTGATGATGAT
AATGGACACAGAAGCAGCAGGTCGCGGTCACAAGGTGGCGACAATAGGAATAGCAATACGAATCCTTTAGGTCCT
TCAGCAGCAACAATTACTAATGCACCATCACATCAAATGCCACCCGAAGAAGAATGGGGCACCATGTTTCAACTT
CGGTCGCCCGGAAACCATGTCGATCCAGGAACAGTAGCAGCAACGGCACAGCGGCCATCTATAACAGATTCAGCT
GCAAGAACATCGCTTGATTCGGTATCGTCATCGGATTCTTCAATGACGGATTCTTTCACAAGTTCTGGAGCTTCC
AGCTTTTCGGCGTCAGGCCCCAACGTTTTACCCTTGCGTGTGCCTAATAGGAGGATGTTCTTGGATACGGAATTA
CCTTCGCCTGGTTTAGGAGGACTTTTTGATACCCTAGGAGCGAACACAATCCCCGCTATTGCTGATTCCCTTACG
ACCGTACCTCGTCCAACACGAAACTCTACAACAAATCCACCTTCTGCACCGTCTTCTGTCGCAGCCATGGCTCCG
ACATCTGATCATTATTCTTCGAATTCATCGTCAGGATTCCTGTCTTCTACTACTGGTCGATTTACACCTTCGCCT
GTTCGAACTTCTGATGGAGATTTGGACGAAGACAGAGTTGTTGCGGATGAAACTGCCAGATTGCATAGCTTGGCT
TCGAGGTTGGGAAATATGAGGGACGAGATGGTTAGTGAGATGATGAATTTGTGGGAAAGACCTCAGGGAGTTGAA
TCTGAAATGAGGATGGATATTGGTGAAGGAGAACCACGTGGCAGAGCTCAGAATATCCATCGCGCTCCGACCGCG
CATAGAACCTCTGTTAGCGATTTCCGCCGTCCTGGCCCTTTTCCACCTCCGTCTTCCACTGCTGTTGCCCAACGC
ACGCGGACAGAAGACTTGACTTTCCCATCTTCTCCCAGCGCCAACGTCGGTAGTACAGGAAGGGAGAGGAGACAT
CCGGGCATTGATACGTCGTTGTTTTCTCCTGGAATATTTAGGAACTCGCTGGAGCCGTACGCAAACAGTGCACGG
GAACACACAGCTCAAGCATCATCTTCTGTTCCTTCATCGTCCTCCTTGCCTGCAGCGTCCAGAGCTACTCCTGTC
CCTGCAACCTCAATCTCCTCACCTACCATGTCTTCTGGTTTTCTTTCCCCTCCCACGGCGTCGCACCCACCTCCT
GTTTCATATATGCTTGCATCAGAACAACCTCCGAGAAATTCTTTAGTTCCTCGACAACAACCTCGTCGCCACTAC
CACCATCACCATCACCATCACCACCATCATAGTCTTTCAGGTAGAACTCAATCACCACCTGTGATTCCACCGCTT
TCATTTGAAAACCATTCTTCCGAAAATGACGCTGCGGCAGCGGCAGCAGGAGCTCGCGCAAGGCAACGATCGGAT
GTGCAAGAGCCCTTGGATAGTGCGGCGAATGAAAATGAACAAATGAGACAGGGATATTTTAGTTTGTTGAGACGT
CAGCAACGAGATGGAATAGCGAGACGAGCAGATGAAACTAGTATTCGTGATGGAGAAAGACCTTCAAATGTAAGG
TCTTCGGCCTCGGCTGCGCCTTCTAACTCTTTATCGTCGTCGTCGCCATCGTCATCGCCGACACCCTTTGAAAGG
AGTTATTTGTCCTGGTCACAATTGGAGAGATTACTGGAGAGATCGCCGGAGAGAACTGAATATCGCACTAGTCCT
GGTTCTTCGAGTCGTGCTGCTGAAAATCGTGTTAGAGGCAATATGGAGGCAATGCGTGTATCGATTGAGAGACAA
CGGAGAATGAGGCGAGAAGCGTTTGATGAACAACGTAGGATTGCGGAGAGGAATGGGGATGTTTTGAGATGGAGG
AATGAGAACAATAACAACAATAATCCGCGTCCATTCCATAATGGTGGTAGCAGTGGCGATGCTCCTACGAGAAAC
ATGGCAACTACGGATGTCCCAAACACTCCTAGCACGATTCCGGATATGCTTTACGATAGAATGCGGCAGTCCCGG
GAAAATATCGCACAAAATGAAAGTGGGTCGACGACGACGACTGTCGGTGGTAACCACAATAATGAAAATGCTGGA
TCTCAACGTAGGAGATGGTATGATGTTGTTCAGGGTAATTTCAGGAGCGTTTTACCAGAAGAGGAGGACGAGGAT
GAAAGTGAAGAAGATTTGTATCGTGAAACTTATCCGACACCGAGACGGTACAGGGATCCACCTCTACCAAATTTT
GGACCAAGAATGCCACTACCACGTTTCGAGTCAAGGTCGCAGGGAGTAATAGAACGTGAAAGAGAGAACTCGACT
ACTCGTCATCGTGGGCCATTAACACACTCTAATCCTGGTAACGTGGGTTGGATTCCGCAGGAAAGAGTTAGTCCT
CGAGCAAGAAATGTTGGAGGTGGACAAGATACAAGTGGGACTAGCGGTAGTCGTGACAATGGTGCTACTGCGGTA
GCAGCGGCTATAAATCATGTCAACCATGTCGGCCGTAGATTGGGAGAGAGGACGATGCATAGGTTAAGAGCGGGT
GCTATGGCTGGTGCTACTAATGGTCCTGGTGGAAATGGTGTTGCTGGTATGATGAGTTTTGGTAGACTCGGAAGG
AGGATTGGAGATTTAGGTGACTATTTGAATGATGACGAGTTTGACGCTTCGTATGAGAGCTTGTTGTCGTTACAA
GAAGCACTTGGGGATGTCAGACCGAGATCAACGCCAGAAGCGGTGTTGAAGAAGCTGAAGACTGGGAAGTATAAA
GAATGGGTGGAGCAAGGAGGTGAAATTAGGTGTCCGATTTGTTTGGAGGATTATAATCCAGAGGATGTCCTCTTG
AAGTCGGGCAACTGTAAGCACTGGATGCATAGAGCGTGTTTGGAGGAATGGTTCAAGAGCGCCAACACTTGTCCT
GTGTGTCGTACGGAAGTTGAGCCGAGGTCACAATCTAGAATGCGGTGCCGTCGACCGGTAGCGTCGGCAAGGAGG
AATCCTGGAAGTGGTAACAGTGGTGATAGAGGAGAGGGTGGAAGCGGAAGTGCAGGCGATCCTGGTTTGGATCCT
AGTTTAGATCCTAATGGATCTGGTCCGGATAGTAACAGCGGGTCTGGTCGCAGCGGTGATTCTGCGGACTTTCTC
GAAAACCTTGACGAGTTTACGGCGGGCAATTGCATGTCTTTGCCAAAGAGGATTATCAAGGAAACGGAGAGACTC
GTTGCGGATCCCGCACCCGGCATTTCTGCTGAACCGCATGAAGATAACCTTCGGTATTTTAACGTGACTATCGAA
GGTCCAGGAGGAAGTCCTTTTGAAAATGGCAAATTCAAGCTTGAGTTGTTTCTTCCGGAAGAGTACCCTATGGCG
CCTCCCAAGGTCCGGTTCTTGACCAAGATATACCACCCCAATATCGATAAACTGGGTCGGATCTGTTTGGATATC
TTGAAGGATAAATGGTCGCCTGCGCTGCAGATTCGGACGGTGCTGTTGTCGATCCAGGCGTTGCTGAGTGCACCG
AATCCCGACGACCCGCTTGCGACGGACGTTGCGAAGCACTACAAGGAGAACGAGAAGGACGCGCAACGGGTGAGC
CGGGAGTGGACGCAGGCGTATGCAGCGTAA
Transcript >AgabiH97|030020
ATGCCTTCTGCTACGGACGATGGTAGGGGATTGCATTTGAGGCTTACACTGTCGTCGGGTTCCATGGCTTCTTCC
ACTGGAGGTCCAACGTCGTTCAAGAGGAGCTTAGAGGAGCTGTTTGGAGGAGCTGAGAGTGATGGGGACGAGGAG
AGGAGTTCAACAGGTGGGGCGGGGGGGATGATGGTTGGTGGTGGCGTTGGGAATGGGGGAGGAAGCAGTAATGGG
CGCAACAAAAGACAGCGCAGTGAAAGCGCTGAGCAGCCACTACAAAACTCGGCCTCGTCGTCGTCGTCTTCGTCG
TCTGCAGCTAATGGACGAGGCCTTTCCCTACCGCCGAGATTGCCTACGCCGAGACTGGACGTTCATATGTCAGAT
ATTCCTCTCTTAGGTTCCAATGAGGGACTCGAATTTTCCTCGCCTCACCGTCGTTCGCAACATCGACTGCAACAT
CGACGACAGTCATCCTCTTCTAGATCCTTATCTCCACTAGTACCCTCCACACCTGCATCCGTATCGACATCGACA
TCTCCTCAATCATCCATTTTTGTAACAACACAACAAACAAACTTGACTTTATCCGCAATCCACAATACTAGTACT
AGCGCGCATGCCACTGCAACGGCAATACCAACTTTGGGCTTAGGACCACCATCGATATCGGCCTCACCGTCCGCT
GTATCTTCATCTTCATTACCCTCATCGTCATCATCGTCATTATCATCTGTGCCGTCGTCTCTGAGCAGATCAGAC
AGGTCTTCTTCGCCGAGTCTTATTCTACCTCTACCCATTTCTCGATCAGCTCAGACTCCTCCCACTGCAACAAGT
ATAGCTGGGAGCTTGCCTTTGCTTTCACCAACAACCGCAACTGAAATTGATACCGGTCCTGGTCCTGGCTCTATT
ATTAATGAGACAGAAGCTTCTCCTAGTACCGCCACTGCTGGAGGTGTGGCTACTTTTCTAGGACCAGAGGAGAGG
TTTAGAGCCACGATGCAGAGGTATAATGTATTTGAGCATGAGATTGCCGCGTTGAGAAGGTCTGTTAGTCCTCCT
GGTTTATCGAGAAGTTTGGCGGTTGCTGGGATGGGGGAACAGCAGCAACAGCAGCAGCGAACTGCGTCACCTCCG
AGGTTACCTCCGTTGGAGTTGAGTACTTTGAGGGATGAAGGTGACGATGTTGACAGTGATGAAGGAGAGGATCAG
GATCAAGTCCGGCCTCTTGGCTCGTTGAGGCATGAAGATGTAGCATCTATTCCTTCGACCGTTTCAGCAAGTAGT
GAACGTTTATCAGCGTCTTCGGCACTACACTTACCAGATAGGAATGCCCAGCGAAACAATCCCGAATCCTTCCTT
GCTTTGTCTGCAGCTGCGGAAGTTTCACCACTACCTCTTGATGAAGATATTGATGAGCTTGAAGATGATGATGCA
GATTTGTTAAGGAGTAATCACCATCACCATCACCATCAACATCAACCAATCTCCGCTCCTCTTCTAGTTCATGGA
CGTAGACACAGACCTGTTCGAGCTGCAGTACGCGATGCTCCACCCAGAATCGAACTACCAAATGCTGTGTGGTCG
TCTTTGGATATTGTTTCTGAAGCCACTCTTCCAACTTCCGCAAGAAATATCACTACCTCCACGACGACGACGACG
ATTCATGATCCAGCCATAGTAGAGTTGGATGGCTCAGGAGAGGATGACGACGAGAGTGATGCTCCTGAAGATGAT
CATGGTAACGATCTTGTTTATCCGCGTTTCAGAGATCACCTCGACTCTGCACTTGAAGCACTTCGATCACCTTCT
TCGCCACTCGTTCCAGGACTCGTACCTAGCGGTATAGAGTCTTCAATTGCTCTAACATCGATCCCCAACAATGAT
AATGAACCGCCCGCTACCATTGTTCTAAATGATTCTGGAGATTATCAGCCTAATCATACATCACCTTCTCCTCCA
CCTGTCATTCGTTCTGCTTTGTCTTTGTCCTCTCCATCCTTCTCGAACGACGTTGTGATTGCGCCAGTACGGGAT
TTACAAACACAGGGTACATCAAATCCTGCTTTATTTTCTTCTCCATTGTCGCAATCGGCACCAACGGCGAATGCG
AATATGGCTCGCAGATTTGGTCGACCTCCTACTTTACCTCCCATACTCACAGAGCCTACCTACTTGAATTATACA
AATTCCAGTTCTGGACATGGGGATAGCAGATACGTTTATCACCGATCAATGATACCGCCCTTGTCATCGTCGTCG
GCATCACCTCGAGAGCGGGACGAACAGTCAACAAGGATAAGAAGAAGGAGAATTTCAATCGACAACGAGAATGAC
CGTAACGAAGATATCGAAGCCGGTGGACAAGCTACTACAAATTCGAGAGGAATGCTTCAGAGATCTTCGAATTTG
GGTGAGGTGGAATTACCTTCACCTTCGTTAAGCGAGTTTTACGATTGGCTGGGAAGTCCTAATAGCCCTGATCCG
GATCTTTTGAGAGACGTTGTTCCGACGACGAGACAAGATAATTCTGTTGGACGTCCGCCTGGGTCGTCTAGGGAG
GTAATGAGAGAGAGGGAGAGGGATGGAGAGCTGGAGAATAGGAGGAGGAGTTGGGAGGAAGATGTTTTATCTGGA
TTCATGAATACTGGAGTTGGGCTTGATTTGAGGCTCCGACAAAGGGAAAGGGAGCAGCAGCAGCAGCAAGAACAA
GAACAACCAATCTCATTACCCCCACCACTTCCTCTCCCCGCAAGACCGACTTCGGAAAGGAGGCTCTCTATGGAC
ACTAGCATTGTTGGAATGGACGTTGATATGGAATCTTCCGAAGATTTGGAGGCCAGGCAAAGAGAATTGGAGCTA
GAAAGGTTACCTTGGACACTGGGGTCGTCCATCACATCGTCGACGACGAGAACGAATCAACACTCTCCTCGACTT
CATCTCCATCGCGAATCGAGACGTTTTACACCATCAGTCTCGATGAGTCGAAGCAGAGAAAGATTGAGGTTGTAC
AATGACATCGAAGTTGATGATGGATGGAATCCATTACATTCGACTCGTCATTGGTATCCTGAATCTGCTCCAGTT
GCATTAACTTCATCATCAATGTCTTCACTACCAACATTTTCTTCGAGTTTATTTTCCTCTCCTTCGTCTCCGCCA
ATATCCACCAATCAATCTACTGGAGTCCATCCTCCCCCTCCTTCCACTGCGGCAACATCGTCGGGTTCAAGACCC
AGATTACCTAATTTCTTGCTACCAACGTCATCGTCGCATAGAAGAGGGCAAAATCATTTGTCTCCTTTTTCGAGG
CACTCTTCTTCTAGTACTACTGCTACTATTACAAGGGAAACAGAAAGGGAAAGAAGACGAAGTTCTGCGGAAAGC
AATGGTTCTTTGCCACCCAGCCTTGAACTCAATCTCGGTCCATCGAGTCATTCCGTTTTTGCGACCAGTGCTGCT
GGTGGTCCTCGTGCAAGTGGTACCGCTGGTGAAGAAGTCTCAGGCCAATACCAACACTCTTCGACGACAACACCG
TCATCGTCATCATCATCTTTGACACCTTTCATACAACTATTCGAACCCCCCACTGCTGTCCCCCCGCCTTCGTTG
GGCCAACAAGCTCCTCTATTATCATCTCAACGAGAAAACCGTCAAAATCAGAGGCAAAGAAACCCGACGGAAATT
GAGGTGCTTGATGGTGACGATGAAGATATGAATGACGATATGGGTGTGGTCTCGAGTGATAATCAACAAAGACAA
CCACTAGAACCATTACCCCATTTACCACAATATGAAGATCGAGAGCGGCAGCGGCAACAACAACAACAACAGGAT
AGGTACAGGTCACTTACACGTATTGTGGGGTCTGATAATTCACTCGTGGCGGAAAATGCAGCTGAGACCAGGAGA
TTGTATGCGAGAATGGATATGGATAGGAGGTTGCATCAACATTCGTTAAATATATCAGTGCCTTCTGCGAGGTCT
TGGGCTTCTGTTGTTGAGGAGGAAGAGGGTTCGAGAAATATTGGTGTAGATGAAGATGTGAGGTACGGCGCGCGT
CGTGTGGAAGTTAGGAGACAGGGGGAGAGTACTGGCGTTGGAGAGTATAGTGAACGGCAGCAGCGAGCTCGGGTT
CTGGCTTCACAGATACAGCATCACCGACGTCAGCGTGCTGATGCCAGTGGTAGGCAGTTACGCTATGAAGAGCCT
GTGTCAAGGCGTTTTACGTGTCACTTTCCAGATTTGCTTGACGGTATTGGGATGGCTCCCAGAGTCACAAATAGC
GGTGGAAGCGGTAGTACTTCAAGTCTAAATGATCGCACATCTGGACCTCGTATTGCTCCACCCCCACCTCGACCT
AGGCTTCATTCCATCCGCCAGGTCCCAGCCCCTTCCGAAAATACTGGGTTTGGCAATGTTCGTGGTGATGATGAT
AATGGACACAGAAGCAGCAGGTCGCGGTCACAAGGTGGCGACAATAGGAATAGCAATACGAATCCTTTAGGTCCT
TCAGCAGCAACAATTACTAATGCACCATCACATCAAATGCCACCCGAAGAAGAATGGGGCACCATGTTTCAACTT
CGGTCGCCCGGAAACCATGTCGATCCAGGAACAGTAGCAGCAACGGCACAGCGGCCATCTATAACAGATTCAGCT
GCAAGAACATCGCTTGATTCGGTATCGTCATCGGATTCTTCAATGACGGATTCTTTCACAAGTTCTGGAGCTTCC
AGCTTTTCGGCGTCAGGCCCCAACGTTTTACCCTTGCGTGTGCCTAATAGGAGGATGTTCTTGGATACGGAATTA
CCTTCGCCTGGTTTAGGAGGACTTTTTGATACCCTAGGAGCGAACACAATCCCCGCTATTGCTGATTCCCTTACG
ACCGTACCTCGTCCAACACGAAACTCTACAACAAATCCACCTTCTGCACCGTCTTCTGTCGCAGCCATGGCTCCG
ACATCTGATCATTATTCTTCGAATTCATCGTCAGGATTCCTGTCTTCTACTACTGGTCGATTTACACCTTCGCCT
GTTCGAACTTCTGATGGAGATTTGGACGAAGACAGAGTTGTTGCGGATGAAACTGCCAGATTGCATAGCTTGGCT
TCGAGGTTGGGAAATATGAGGGACGAGATGGTTAGTGAGATGATGAATTTGTGGGAAAGACCTCAGGGAGTTGAA
TCTGAAATGAGGATGGATATTGGTGAAGGAGAACCACGTGGCAGAGCTCAGAATATCCATCGCGCTCCGACCGCG
CATAGAACCTCTGTTAGCGATTTCCGCCGTCCTGGCCCTTTTCCACCTCCGTCTTCCACTGCTGTTGCCCAACGC
ACGCGGACAGAAGACTTGACTTTCCCATCTTCTCCCAGCGCCAACGTCGGTAGTACAGGAAGGGAGAGGAGACAT
CCGGGCATTGATACGTCGTTGTTTTCTCCTGGAATATTTAGGAACTCGCTGGAGCCGTACGCAAACAGTGCACGG
GAACACACAGCTCAAGCATCATCTTCTGTTCCTTCATCGTCCTCCTTGCCTGCAGCGTCCAGAGCTACTCCTGTC
CCTGCAACCTCAATCTCCTCACCTACCATGTCTTCTGGTTTTCTTTCCCCTCCCACGGCGTCGCACCCACCTCCT
GTTTCATATATGCTTGCATCAGAACAACCTCCGAGAAATTCTTTAGTTCCTCGACAACAACCTCGTCGCCACTAC
CACCATCACCATCACCATCACCACCATCATAGTCTTTCAGGTAGAACTCAATCACCACCTGTGATTCCACCGCTT
TCATTTGAAAACCATTCTTCCGAAAATGACGCTGCGGCAGCGGCAGCAGGAGCTCGCGCAAGGCAACGATCGGAT
GTGCAAGAGCCCTTGGATAGTGCGGCGAATGAAAATGAACAAATGAGACAGGGATATTTTAGTTTGTTGAGACGT
CAGCAACGAGATGGAATAGCGAGACGAGCAGATGAAACTAGTATTCGTGATGGAGAAAGACCTTCAAATGTAAGG
TCTTCGGCCTCGGCTGCGCCTTCTAACTCTTTATCGTCGTCGTCGCCATCGTCATCGCCGACACCCTTTGAAAGG
AGTTATTTGTCCTGGTCACAATTGGAGAGATTACTGGAGAGATCGCCGGAGAGAACTGAATATCGCACTAGTCCT
GGTTCTTCGAGTCGTGCTGCTGAAAATCGTGTTAGAGGCAATATGGAGGCAATGCGTGTATCGATTGAGAGACAA
CGGAGAATGAGGCGAGAAGCGTTTGATGAACAACGTAGGATTGCGGAGAGGAATGGGGATGTTTTGAGATGGAGG
AATGAGAACAATAACAACAATAATCCGCGTCCATTCCATAATGGTGGTAGCAGTGGCGATGCTCCTACGAGAAAC
ATGGCAACTACGGATGTCCCAAACACTCCTAGCACGATTCCGGATATGCTTTACGATAGAATGCGGCAGTCCCGG
GAAAATATCGCACAAAATGAAAGTGGGTCGACGACGACGACTGTCGGTGGTAACCACAATAATGAAAATGCTGGA
TCTCAACGTAGGAGATGGTATGATGTTGTTCAGGGTAATTTCAGGAGCGTTTTACCAGAAGAGGAGGACGAGGAT
GAAAGTGAAGAAGATTTGTATCGTGAAACTTATCCGACACCGAGACGGTACAGGGATCCACCTCTACCAAATTTT
GGACCAAGAATGCCACTACCACGTTTCGAGTCAAGGTCGCAGGGAGTAATAGAACGTGAAAGAGAGAACTCGACT
ACTCGTCATCGTGGGCCATTAACACACTCTAATCCTGGTAACGTGGGTTGGATTCCGCAGGAAAGAGTTAGTCCT
CGAGCAAGAAATGTTGGAGGTGGACAAGATACAAGTGGGACTAGCGGTAGTCGTGACAATGGTGCTACTGCGGTA
GCAGCGGCTATAAATCATGTCAACCATGTCGGCCGTAGATTGGGAGAGAGGACGATGCATAGGTTAAGAGCGGGT
GCTATGGCTGGTGCTACTAATGGTCCTGGTGGAAATGGTGTTGCTGGTATGATGAGTTTTGGTAGACTCGGAAGG
AGGATTGGAGATTTAGGTGACTATTTGAATGATGACGAGTTTGACGCTTCGTATGAGAGCTTGTTGTCGTTACAA
GAAGCACTTGGGGATGTCAGACCGAGATCAACGCCAGAAGCGGTGTTGAAGAAGCTGAAGACTGGGAAGTATAAA
GAATGGGTGGAGCAAGGAGGTGAAATTAGGTGTCCGATTTGTTTGGAGGATTATAATCCAGAGGATGTCCTCTTG
AAGTCGGGCAACTGTAAGCACTGGATGCATAGAGCGTGTTTGGAGGAATGGTTCAAGAGCGCCAACACTTGTCCT
GTGTGTCGTACGGAAGTTGAGCCGAGGTCACAATCTAGAATGCGGTGCCGTCGACCGGTAGCGTCGGCAAGGAGG
AATCCTGGAAGTGGTAACAGTGGTGATAGAGGAGAGGGTGGAAGCGGAAGTGCAGGCGATCCTGGTTTGGATCCT
AGTTTAGATCCTAATGGATCTGGTCCGGATAGTAACAGCGGGTCTGGTCGCAGCGGTGATTCTGCGGACTTTCTC
GAAAACCTTGACGAGTTTACGGCGGGCAATTGCATGTCTTTGCCAAAGAGGATTATCAAGGAAACGGAGAGACTC
GTTGCGGATCCCGCACCCGGCATTTCTGCTGAACCGCATGAAGATAACCTTCGGTATTTTAACGTGACTATCGAA
GGTCCAGGAGGAAGTCCTTTTGAAAATGGCAAATTCAAGCTTGAGTTGTTTCTTCCGGAAGAGTACCCTATGGCG
CCTCCCAAGGTCCGGTTCTTGACCAAGATATACCACCCCAATATCGATAAACTGGGTCGGATCTGTTTGGATATC
TTGAAGGATAAATGGTCGCCTGCGCTGCAGATTCGGACGGTGCTGTTGTCGATCCAGGCGTTGCTGAGTGCACCG
AATCCCGACGACCCGCTTGCGACGGACGTTGCGAAGCACTACAAGGAGAACGAGAAGGACGCGCAACGGGTGAGC
CGGGAGTGGACGCAGGCGTATGCAGCGTAA
Gene >AgabiH97|030020
ATGCCTTCTGCTACGGACGATGGTAGGGGATTGCATTTGAGGCTTACACTGTCGTCGGGTTCCATGGCTTCTTCC
ACTGGAGGTCCAACGTCGTTCAAGAGGAGCTTAGAGGAGCTGTTTGGAGGAGCTGAGAGTGATGGGGACGAGGAG
AGGAGTTCAACAGGTGGGGCGGGGGGGATGATGGTTGGTGGTGGCGTTGGGAATGGGGGAGGAAGCAGTAATGGG
CGCAACAAAAGACAGCGCAGTGAAAGCGCTGAGCAGCCACTACAAAACTCGGCCTCGTCGTCGTCGTCTTCGTCG
TCTGCAGCTAATGGACGAGGCCTTTCCCTACCGCCGAGATTGCCTACGCCGAGACTGGACGTTCATATGTCAGAT
ATTCCTCTCTTAGGTTCCAATGAGGGACTCGAATTTTCCTCGCCTCACCGTCGTTCGCAACATCGACTGCAACAT
CGACGACAGTCATCCTCTTCTAGATCCTTATCTCCACTAGTACCCTCCACACCTGCATCCGTATCGACATCGACA
TCTCCTCAATCATCCATTTTTGTAACAACACAACAAACAAACTTGACTTTATCCGCAATCCACAATACTAGTACT
AGCGCGCATGCCACTGCAACGGCAATACCAACTTTGGGCTTAGGACCACCATCGATATCGGCCTCACCGTCCGCT
GTATCTTCATCTTCATTACCCTCATCGTCATCATCGTCATTATCATCTGTGCCGTCGTCTCTGAGCAGATCAGAC
AGGTCTTCTTCGCCGAGTCTTATTCTACCTCTACCCATTTCTCGATCAGCTCAGACTCCTCCCACTGCAACAAGT
ATAGCTGGGAGCTTGCCTTTGCTTTCACCAACAACCGCAACTGAAATTGATACCGGTCCTGGTCCTGGCTCTATT
ATTAATGAGACAGAAGCTTCTCCTAGTACCGCCACTGCTGGAGGTGTGGCTACTTTTCTAGGACCAGAGGAGAGG
TTTAGAGCCACGATGCAGAGGTATAATGTATTTGAGCATGAGATTGCCGCGTTGAGAAGGTCTGTTAGTCCTCCT
GGTTTATCGAGAAGTTTGGCGGTTGCTGGGATGGGGGAACAGCAGCAACAGCAGCAGCGAACTGCGTCACCTCCG
AGGTTACCTCCGTTGGAGTTGAGTACTTTGAGGGATGAAGGTGACGATGTTGACAGTGATGAAGGAGAGGATCAG
GATCAAGTCCGGCCTCTTGGTAAATGCCTCGTTTTTGTTGAAACACTTTTTTTACTGATCATGTTATCTATTTTT
CAAGGCTCGTTGAGGCATGAAGATGTAGCATCTATTCCTTCGACCGTTTCAGCAAGTAGTGAACGTTTATCAGCG
TCTTCGGCACTACACTTACCAGATAGGAATGCCCAGCGAAACAATCCCGAATCCTTCCTTGCTTTGTCTGCAGCT
GCGGAAGTTTCACCACTACCTCTTGATGAAGATATTGATGAGCTTGAAGATGATGATGCAGATTTGTTAAGGAGT
AATCACCATCACCATCACCATCAACATCAACCAATCTCCGCTCCTCTTCTAGTTCATGGACGTAGACACAGACCT
GTTCGAGCTGCAGTACGCGATGCTCCACCCAGAATCGAACTACCAAATGCTGTGTGGTCGTCTTTGGATATTGTT
TCTGAAGCCACTCTTCCAACTTCCGCAAGAAATATCACTACCTCCACGACGACGACGACGATTCATGATCCAGCC
ATAGTAGAGTTGGATGGCTCAGGAGAGGATGACGACGAGAGTGATGCTCCTGAAGATGATCATGGTAACGATCTT
GTTTATCCGCGTTTCAGAGATCACCTCGACTCTGCACTTGAAGCACTTCGATCACCTTCTTCGCCACTCGTTCCA
GGACTCGTACCTAGCGGTATAGAGTCTTCAATTGCTCTAACATCGATCCCCAACAATGATAATGAACCGCCCGCT
ACCATTGTTCTAAATGATTCTGGAGATTATCAGCCTAATCATACATCACCTTCTCCTCCACCTGTCATTCGTTCT
GCTTTGTCTTTGTCCTCTCCATCCTTCTCGAACGACGTTGTGATTGCGCCAGTACGGGATTTACAAACACAGGGT
ACATCAAATCCTGCTTTATTTTCTTCTCCATTGTCGCAATCGGCACCAACGGCGAATGCGAATATGGCTCGCAGA
TTTGGTCGACCTCCTACTTTACCTCCCATACTCACAGAGCCTACCTACTTGAATTATACAAATTCCAGTTCTGGA
CATGGGGATAGCAGATACGTTTATCACCGATCAATGATACCGCCCTTGTCATCGTCGTCGGCATCACCTCGAGAG
CGGGACGAACAGTCAACAAGGATAAGAAGAAGGAGAATTTCAATCGACAACGAGAATGACCGTAACGAAGATATC
GAAGCCGGTGGACAAGCTACTACAAATTCGAGAGGAATGCTTCAGAGATCTTCGAATTTGGGTGAGGTGGAATTA
CCTTCACCTTCGTTAAGCGAGTTTTACGATTGGCTGGGAAGTCCTAATAGCCCTGATCCGGATCTTTTGAGAGAC
GTTGTTCCGACGACGAGACAAGATAATTCTGTTGGACGTCCGCCTGGGTCGTCTAGGGAGGTAATGAGAGAGAGG
GAGAGGGATGGAGAGCTGGAGAATAGGAGGAGGAGTTGGGAGGAAGATGTTTTATCTGGTTAGTGCCTTTTCTTT
TCACTTGGTCTAGCTTACTTAATGTTCTCCTCATTTCAGGATTCATGAATACTGGAGTTGGGCTTGATTTGAGGC
TCCGACAAAGGGAAAGGGAGCAGCAGCAGCAGCAAGAACAAGAACAACCAATCTCATTACCCCCACCACTTCCTC
TCCGTATGTTCATCTTTATCTTCCTTATCTGGTCCTGAATTCTTATGTCATGAATCGTTTAGCCGCAAGACCGAC
TTCGGAAAGGAGGCTCTCTATGGACACTAGCATTGTTGGAATGGACGTTGATATGGAATCTTCCGAAGATTTGGA
GGCCAGGCAAAGAGAATTGGAGCTAGAAAGGTTACCTTGGACACTGGGGTCGTCCATCACATCGTCGACGACGAG
AACGAATCAACACTCTCCTCGACTTCATCTCCGTGAGTGTTTTTTCTCTTTTCGCAAGTTATAATAACATTTTTA
TTGAGATTATGTGTTAGATCGCGAATCGAGACGTTTTACACCATCAGTCTCGATGAGTCGAAGCAGAGAAAGATT
GAGGTTGTACAGTGAGTCTTCATAAATGTCACTTAACTTTCAGGACTGATGTCGTATATAGATGACATCGAAGTT
GATGATGGATGGAATCCATTACATTCGACTCGTCATTGGTATCCTGAATCTGCTCCAGTTGCATTAACTTCATCA
TCAATGTCTTCACTACCAACATTTTCTTCGAGTTTATTTTCCTCTCCTTCGTCTCCGCCAATATCCACCAATCAA
TCTACTGGAGTCCATCCTCCCCCTCCTTCCACTGCGGCAACATCGTCGGGTTCAAGACCCAGATTACCTAATTTC
TTGCTACCAACGTCATCGTCGCATAGAAGAGGGCAAAATCATTTGTCTCCTTTTTCGAGGCACTCTTCTTCTAGT
ACTACTGCTACTATTACAAGGGAAACAGAAAGGGAAAGAAGACGAAGTTCTGCGGAAAGCAATGGTTCTTTGCCA
CCCAGCCTTGAACTCAATCTCGGTCCATCGAGTCATTCCGTTTTTGCGACCAGTGCTGCTGGTGGTCCTCGTGCA
AGTGGTACCGCTGGTGAAGAAGTCTCAGGCCAATACCAACACTCTTCGACGACAACACCGTCATCGTCATCATCA
TCTTTGACACCTTTCATACAACTATTCGAACCCCCCACTGCTGTCCCCCCGCCTTCGTTGGGCCAACAAGCTCCT
CTATTATCATCTCAACGAGAAAACCGTCAAAATCAGAGGCAAAGAAACCCGACGGAAATTGAGGTGCTTGATGGT
GACGATGAAGATATGAATGACGATATGGGTGTGGTCTCGAGTGATAATCAACAAAGACAACCACTAGAACCATTA
CCCCATTTACCACAATATGAAGATCGAGAGCGGCAGCGGCAACAACAACAACAACAGGATAGGTACAGGTCACTT
ACACGTATTGTGGGGTCTGATAATTCACTCGTGGCGGAAAATGCAGCTGAGACCAGGAGATTGTATGCGAGAATG
GATATGGATAGGAGGTTGCATCAACATTCGTTAAATATATCAGTGCCTTCTGCGAGGTCTTGGGCTTCTGTTGTT
GAGGAGGAAGAGGGTTCGAGAAATATTGGTGTAGATGAAGATGTGAGGTACGGCGCGCGTCGTGTGGAAGTTAGG
AGACAGGGGGAGAGTACTGGCGTTGGAGAGTATAGTGAACGGCAGCAGCGAGCTCGGGTTCTGGCTTCACAGATA
CAGCATCACCGACGTCAGCGTGCTGATGCCAGTGGTAGGCAGTTACGCTATGAAGAGCCTGTGTCAAGGCGTTTT
ACGTGTCACTTTCCAGATTTGCTTGACGGTATTGGGATGGCTCCCAGAGTCACAAATAGCGGTGGAAGCGGTAGT
ACTTCAAGTCTAAATGATCGCACATCTGGACCTCGTATTGCTCCACCCCCACCTCGACCTAGGCTTCATTCCATC
CGCCAGGTCCCAGCCCCTTCCGAAAATACTGGGTTTGGCAATGTTCGTGGTGATGATGATAATGGACACAGAAGC
AGCAGGTCGCGGTCACAAGGTGGCGACAATAGGAATAGCAATACGAATCCTTTAGGTCCTTCAGCAGCAACAATT
ACTAATGCACCATCACATCAAATGCCACCCGAAGAAGAATGGGGCACCATGTTTCAACTTCGGTCGCCCGGAAAC
CATGTCGATCCAGGAACAGTAGCAGCAACGGCACAGCGGCCATCTATAACAGATTCAGCTGCAAGAACATCGCTT
GATTCGGTATCGTCATCGGATTCTTCAATGACGGATTCTTTCACAAGTTCTGGAGCTTCCAGCTTTTCGGCGTCA
GGCCCCAACGTTTTACCCTTGCGTGTGCCTAATAGGAGGATGTTCTTGGATACGGAATTACCTTCGCCTGGTTTA
GGAGGACTTTTTGATACCCTAGGAGCGAACACAATCCCCGCTATTGCTGATTCCCTTACGACCGTACCTCGTCCA
ACACGAAACTCTACAACAAATCCACCTTCTGCACCGTCTTCTGTCGCAGCCATGGCTCCGACATCTGATCATTAT
TCTTCGAATTCATCGTCAGGATTCCTGTCTTCTACTACTGGTCGATTTACACCTTCGCCTGTTCGAACTTCTGAT
GGAGATTTGGACGAAGACAGAGTTGTTGCGGATGAAACTGCCAGATTGCATAGCTTGGCTTCGAGGTTGGGAAAT
ATGAGGGACGAGATGGTTAGTGAGATGATGAATTTGTGGGAAAGACCTCAGGGAGTTGAATCTGAAATGAGGATG
GATATTGGTGAAGGAGAACCACGTGGCAGAGCTCAGAATGTAAGTTTTTTCCTTTTGATTTCTGATTCTTACTGC
CAATTTATGAGGACTTCATTCGATAGATCCATCGCGCTCCGACCGCGCATAGAACCTCTGTTAGCGATTTCCGCC
GTCCTGGCCCTTTTCCACCTCCGTCTTCCACTGCTGTTGCCCAACGCACGCGGACAGAAGACTTGACTTTCCCAT
CTTCTCCCAGCGCCAACGTCGGTAGTACAGGAAGGGAGAGGAGACATCCGGGCATTGATACGTCGTTGTTTTCTC
CTGGAATATTTAGGAACTCGCTGGAGCCGTACGCAAACAGTGCACGGGAACACACAGCTCAAGCATCATCTTCTG
TTCCTTCATCGTCCTCCTTGCCTGCAGCGTCCAGAGCTACTCCTGTCCCTGCAACCTCAATCTCCTCACCTACCA
TGTCTTCTGGTTTTCTTTCCCCTCCCACGGCGTCGCACCCACCTCCTGTTTCATATATGCTTGCATCAGAACAAC
CTCCGAGAAATTCTTTAGTTCCTCGACAACAACCTCGTCGCCACTACCACCATCACCATCACCATCACCACCATC
ATAGTCTTTCAGGTAGAACTCAATCACCACCTGTGATTCCACCGCTTTCATTTGAAAACCATTCTTCCGAAAATG
ACGCTGCGGCAGCGGCAGCAGGAGCTCGCGCAAGGCAACGATCGGATGTGCAAGAGCCCTTGGATAGTGCGGCGA
ATGAAAATGAACAAATGAGACAGGGATATTTTAGTTTGTTGAGACGTCAGCAACGAGATGGAATAGCGAGACGAG
CAGATGAAACTAGTATTCGTGATGGAGAAAGACCTTCAAATGTAAGGTCTTCGGCCTCGGCTGCGCCTTCTAACT
CTTTATCGTCGTCGTCGCCATCGTCATCGCCGACACCCTTTGAAAGGAGTTATTTGTCCTGGTCACAATTGGAGA
GATTACTGGAGAGATCGCCGGAGAGAACTGAATATCGCACTAGTCCTGGTTCTTCGAGTCGTGCTGCTGAAAATC
GTGTTAGAGGCAATATGGAGGCAATGCGTGTATCGATTGAGAGACAACGGAGAATGAGGCGAGAAGCGTTTGATG
AACAACGTAGGATTGCGGAGAGGAATGGGGATGTTTTGAGATGGAGGAATGAGAACAATAACAACAATAATCCGC
GTCCATTCCATAATGGTGGTAGCAGTGGCGATGCTCCTACGAGAAACATGGCAACTACGGATGTCCCAAACACTC
CTAGCACGATTCCGGATATGCTTTACGATAGAATGCGGCAGTCCCGGGAAAATATCGCACAAAATGAAAGTGGGT
CGACGACGACGACTGTCGGTGGTAACCACAATAATGAAAATGCTGGATCTCAACGTAGGAGATGGTATGATGTTG
TTCAGGGTAATTTCAGGAGCGTTTTACCAGAAGAGGAGGACGAGGATGAAAGTGAAGAAGATTTGTATCGTGAAA
CTTATCCGACACCGAGACGGTACAGGGATCCACCTCTACCAAATTTTGGACCAAGAATGCCACTACCACGTTTCG
AGTCAAGGTCGCAGGGAGTAATAGAACGTGAAAGAGAGAACTCGACTACTCGTCATCGTGGGCCATTAACACACT
CTAATCCTGGTAACGTGGGTTGGATTCCGCAGGAAAGAGTTAGTCCTCGAGCAAGAAATGTTGGAGGTGGACAAG
ATACAAGTGGGACTAGCGGTAGTCGTGACAATGGTGCTACTGCGGTAGCAGCGGCTATAAATCATGTCAACCATG
TCGGCCGTAGATTGGGAGAGAGGACGATGCATAGGTTAAGAGCGGGTGCTATGGCTGGTGCTACTAATGGTCCTG
GTGGAAATGGTGTTGCTGGTATGATGAGTTTTGGTAGACTCGGAAGGAGGATTGGAGATTTAGGTGACTATTTGG
TAAGTCAAAACCCTTCTAATGGTTTATCTCGGTTATTTGATCTGATTGTTATTAGAATGATGACGAGTTTGACGC
TTCGTATGAGAGCTTGTTGTCGTTACAAGAAGCACTTGGGGATGTCAGACCGAGATCAACGCCAGAAGCGGTGTT
GAAGAAGCTGAAGACTGGGAAGTATAAAGAATGGGTGGAGCAAGGAGGTGAAATTAGGTGTCCGATTTGTTTGGA
GGATGTACGTTTCTCTGATTTCTTTCTCTTTGGGGTGTAAGCTCATACTTTGTACCAGTATAATCCAGAGGATGT
CCTCTTGAAGTCGGGCAACTGTAAGCACTGGATGCATAGAGCGTGTTTGGAGGTATGTTATAGTGACTTGACTTG
CTTTGTAAGTTCAAGTGACTGACTGGGCTTCAAGGAATGGTTCAAGAGCGCCAACACTTGTCCTGTGTGTCGTAC
GGAAGTTGAGCCGAGGTCACAATCTAGAATGCGGTGCCGTCGACCGGTAGCGTCGGCAAGGAGGAATCCTGGAAG
TGGTAACAGTGGTGATAGAGGAGAGGGTGGAAGCGGAAGTGCAGGCGATCCTGGTTTGGATCCTAGTTTAGATCC
TAATGGATCTGGTCCGGATAGTAACAGCGGGTCTGGTCGCAGCGGTGATTCTGGTAGTGGAGAGTTTTGGTAGAA
TTAAGTTTGTTTTATGCGCGTCCCTCATCTGGTTTTATACTGGCATCTGTTTCTATTATATAGCTTGTTATCTAA
CATGTAAAAGTACTGATAGTCTGCAACTGAAATGCGATACTGACAGGGAACTTAATTTAGATAAGATGAGTCAGC
GTTGCCTGATGCAGTTGCCAGAGCTGTTCCATCCACCCACCACCACCATCTCTGTTTCCTCTTTTCCAACAAGCG
GACTTTCTCGAAAACCTTGACGGTGAGTGCGTATCGCTGTATGTCTGATAGCCAGACGAAGGCTGAAGAGACGAG
CTTGCTTAACCGCTTCAGTATTTTAGAGTTTACGGCGGGCAATTGGTATATCACGCTACCCTCACGATTCTGTGG
CACGCCGTGTTTATAAGATTTTTTGAGTGATTTTTAGCATGTCTTTGCCAAAGGTGTGTCGCGATTTATAATGGC
AAGATCATAGCTGACGGATGGACTGCATTGGCTTTCGATAATCTTGTCGCTTTATCTGACATTACCGTGTCTCTA
TCGGTATCTGTTGGCGTAATGTATCACTCTGCAGAGGATTATCAAGGTCTGGATCTGTGGTTGATGAGGGCGACA
TCATTCTCAACCGCGTCTCTTTGACAGGAAACGGAGAGACTCGTTGCGGATCCCGCACCCGGCATTTCTGCTGAA
CCGCATGAAGATAACCTTCGGTATTTTAACGTGACTATCGAAGGTCCAGGAGGAAGTCCTTTTGAAAGTGAGTAA
TTTAGATTCTGGGGTCGAAGGGGGCTGGATTGTGATCAACTCCTTTTTGTAGATGGCAAATTCAAGCTTGAGTTG
TTTCTTCCGGAAGAGTACCCTATGGCGCCTCCCAAGGTCCGGTTCTTGACCAAGATATACCACCCCAATATCGGT
ACGTGGGGGTGTCTATTTACGGAATGACCGGAAATGAACTCTTCCTCAAGATAAACTGGGTCGGATCTGTTTGGA
TATCTTGAAGGGTAGGATCTGAGTTTAGAGATGAACGAGCTAGTGCTTATTTTGCATTTTTTTAGATAAATGGTC
GCCTGCGCTGCAGATTCGGACGGTGCTGTTGTCGATCCAGGCGTTGCTGAGTGCACCGAATCCCGACGACCCGCT
TGCGACGGACGTTGCGAAGCACTACAAGGAGAACGAGAAGGACGCGCAACGGGTGAGCCGGGAGTGGACGCAGGC
GTATGCAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail