Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029980
Gene name
Locationscaffold_12:482900..483758
Strand+
Gene length (bp)858
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 139 161 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029980
MRSFASIATFATLAFASLASALPTLNANGVALSNRDVSGVAAPAPESLNVPHSGRGEPAQVAEHSVVQIIVDVTA
EIRPLCDKLSAAISGDVEVKVAVDTSLQILGEIKGSLVKAKVDIEAAIAAGVDLLVLDGKTLAVHVVAQILAVLI
VIVTTVLGLVVKVCASANVEALVSLMVEINFCLADIIGLVVKICVGLLVELKPLVECIVNILIKLDLKALIKVLA
VVQA*
Coding >AgabiH97|029980
ATGCGCTCCTTCGCTTCTATCGCTACCTTCGCCACTCTTGCCTTTGCATCTCTGGCTTCGGCTCTCCCGACCCTC
AATGCCAACGGCGTTGCGCTTTCCAACAGGGACGTTTCTGGCGTTGCCGCTCCTGCACCAGAATCTCTGAACGTT
CCCCACTCGGGCCGTGGTGAACCTGCTCAGGTGGCGGAGCACTCGGTTGTTCAGATCATCGTCGACGTTACCGCT
GAAATCAGACCTCTTTGCGACAAATTGTCTGCTGCCATCTCCGGGGACGTTGAGGTCAAGGTCGCAGTCGATACT
TCTCTCCAGATTCTGGGCGAAATCAAGGGTAGTCTTGTGAAGGCTAAAGTTGATATTGAGGCTGCTATTGCTGCT
GGCGTCGACCTTCTTGTACTTGACGGCAAGACTTTGGCTGTGCACGTCGTTGCGCAAATACTTGCTGTTCTCATC
GTCATCGTCACTACGGTTCTCGGTCTCGTCGTCAAGGTCTGCGCTTCTGCCAACGTCGAGGCTCTCGTCAGCCTC
ATGGTTGAGATTAACTTCTGCCTCGCTGATATCATTGGCCTTGTTGTCAAGATCTGCGTTGGTCTCCTTGTTGAG
CTCAAGCCTCTCGTCGAGTGCATTGTCAACATCCTTATCAAGCTTGACCTCAAGGCTCTCATCAAGGTTTTAGCA
GTTGTTCAGGCTTAG
Transcript >AgabiH97|029980
ATGCGCTCCTTCGCTTCTATCGCTACCTTCGCCACTCTTGCCTTTGCATCTCTGGCTTCGGCTCTCCCGACCCTC
AATGCCAACGGCGTTGCGCTTTCCAACAGGGACGTTTCTGGCGTTGCCGCTCCTGCACCAGAATCTCTGAACGTT
CCCCACTCGGGCCGTGGTGAACCTGCTCAGGTGGCGGAGCACTCGGTTGTTCAGATCATCGTCGACGTTACCGCT
GAAATCAGACCTCTTTGCGACAAATTGTCTGCTGCCATCTCCGGGGACGTTGAGGTCAAGGTCGCAGTCGATACT
TCTCTCCAGATTCTGGGCGAAATCAAGGGTAGTCTTGTGAAGGCTAAAGTTGATATTGAGGCTGCTATTGCTGCT
GGCGTCGACCTTCTTGTACTTGACGGCAAGACTTTGGCTGTGCACGTCGTTGCGCAAATACTTGCTGTTCTCATC
GTCATCGTCACTACGGTTCTCGGTCTCGTCGTCAAGGTCTGCGCTTCTGCCAACGTCGAGGCTCTCGTCAGCCTC
ATGGTTGAGATTAACTTCTGCCTCGCTGATATCATTGGCCTTGTTGTCAAGATCTGCGTTGGTCTCCTTGTTGAG
CTCAAGCCTCTCGTCGAGTGCATTGTCAACATCCTTATCAAGCTTGACCTCAAGGCTCTCATCAAGGTTTTAGCA
GTTGTTCAGGCTTAG
Gene >AgabiH97|029980
ATGCGCTCCTTCGCTTCTATCGCTACCTTCGCCACTCTTGCCTTTGCATCTCTGGCTTCGGCTCTCCCGACCCTC
AATGCCAACGGCGTTGCGCTTTCCAACAGGGTGAGTTGCATTCCGGGATCCATTATTCAAGCTAATCCTTTATTT
GAAAGGACGTTTCTGGCGTTGCCGCTCCTGCACCAGAATCTCTGAACGTTCCCCACTCGGGCCGTGGTGAACCTG
CTCAGGTGGCGGAGCACTCGGTTGTTCAGATCATCGTCGACGTTACCGCTGAAATCAGACCTCTTTGCGACAAAT
TGTGTACGTCCCAGCAGCGTTCCTTGTGGTACTTGAAATTTACGACGTCATCTTGACCCGTTTTAGCTGCTGCCA
TCTCCGGGGACGTTGAGGTCAAGGTCGCAGTCGATACTTCTCTCCAGATTCTGGGCGAAATCAAGGGTAGTCTTG
TGAAGGCTAAAGTTGATATTGAGGCTGCTATTGCTGCTGGCGTCGACCTTCTTGTACTTGACGGCAAGACTTTGG
CTGTGCACGTCGTTGCGCAAATACTTGCTGTTCTCATCGTCGTACGTTCACCTCCCCCGCTCATCATTTCCATTC
TGAAAAGGATTTTTTTTGTAGATCGTCACTACGGTTCTCGGTCTCGTCGTCAAGGTCTGCGCTTCTGCCAACGTC
GAGGCTCTCGTCAGCCTCATGGTTGAGATTAACTTCTGCCTCGCTGATATCATTGGCCTTGTTGTCAAGATCTGC
GTTGGTCTCCTTGTTGAGCTCAAGCCTCTCGTCGAGTGCATTGTCAACATCCTTATCAAGCTTGACCTCAAGGCT
CTCATCAAGGTTTTAGCAGTTGTTCAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail