Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029810
Gene name
Locationscaffold_12:448587..452006
Strand-
Gene length (bp)3419
Transcript length (bp)3228
Coding sequence length (bp)3228
Protein length (aa) 1076

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18044 zf-CCCH_4 CCCH-type zinc finger 1.3E-07 13 32
PF18044 zf-CCCH_4 CCCH-type zinc finger 5.9E-08 79 100
PF01485 IBR IBR domain, a half RING-finger domain 3.8E-09 775 835
PF01485 IBR IBR domain, a half RING-finger domain 3.0E-07 851 893
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 9.3E-04 14 32
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.9E-01 80 99
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.4E-04 13 32
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.1E-04 706 739

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 657 911 1.0E-39
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 657 911 1.0E-37
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 703 893 5.0E-19
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 721 906 1.0E-17
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 706 893 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 657 911 1.0E-39
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 657 911 1.0E-37
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 703 893 5.0E-19
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 721 906 1.0E-17
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 706 893 1.0E-17
sp|Q54CX4|Y5521_DICDI Uncharacterized protein DDB_G0292642 OS=Dictyostelium discoideum GN=DDB_G0292642 PE=3 SV=2 706 897 1.0E-17
sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 721 906 2.0E-17
sp|Q8BKD6|R144B_MOUSE E3 ubiquitin-protein ligase RNF144B OS=Mus musculus GN=Rnf144b PE=2 SV=2 721 906 3.0E-17
sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 721 906 7.0E-17
sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 721 906 2.0E-16
sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 703 912 4.0E-16
sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 687 918 5.0E-16
sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 699 918 8.0E-16
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 706 918 8.0E-16
sp|Q925F3|R144A_MOUSE E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 721 906 1.0E-15
sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 703 912 2.0E-15
sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 706 905 3.0E-15
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 691 898 6.0E-15
sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 658 912 7.0E-15
sp|P50876|R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 721 906 7.0E-15
sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 706 895 7.0E-15
sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 721 906 2.0E-14
sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=1 SV=1 684 898 4.0E-14
sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 684 898 4.0E-14
sp|Q22431|ARI2_CAEEL Probable protein ariadne-2 OS=Caenorhabditis elegans GN=T12E12.1 PE=3 SV=2 695 898 4.0E-14
sp|Q6ZMZ0|RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens GN=RNF19B PE=1 SV=2 688 892 2.0E-13
sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 706 891 5.0E-13
sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 696 896 8.0E-13
sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 690 896 1.0E-12
sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=1 SV=3 690 896 1.0E-12
sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 690 896 1.0E-12
sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 696 896 1.0E-12
sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 690 896 1.0E-12
sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 690 896 1.0E-12
sp|A2A7Q9|RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus GN=Rnf19b PE=1 SV=2 706 892 3.0E-12
sp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6 OS=Arabidopsis thaliana GN=ARI6 PE=5 SV=1 703 918 4.0E-12
sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 706 892 4.0E-12
sp|Q84RR2|ARI2_ARATH Probable E3 ubiquitin-protein ligase ARI2 OS=Arabidopsis thaliana GN=ARI2 PE=2 SV=1 719 891 4.0E-12
sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 706 913 6.0E-12
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 702 912 8.0E-12
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 706 906 2.0E-11
sp|Q2VJ60|RN19A_PIG E3 ubiquitin-protein ligase RNF19A OS=Sus scrofa GN=RNF19A PE=2 SV=1 690 892 4.0E-11
sp|Q9NV58|RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens GN=RNF19A PE=1 SV=3 690 892 4.0E-11
sp|Q8IWT3|CUL9_HUMAN Cullin-9 OS=Homo sapiens GN=CUL9 PE=1 SV=2 706 913 6.0E-11
sp|P50636|RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus GN=Rnf19a PE=1 SV=2 690 892 6.0E-11
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 706 891 7.0E-11
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 706 912 2.0E-10
sp|Q6ZPS6|AKIB1_MOUSE Ankyrin repeat and IBR domain-containing protein 1 OS=Mus musculus GN=Ankib1 PE=1 SV=2 702 912 5.0E-10
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 706 915 5.0E-10
sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 812 905 1.0E-09
sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=4 812 905 1.0E-09
sp|Q1L8L6|RN19B_DANRE E3 ubiquitin-protein ligase RNF19B OS=Danio rerio GN=rnf19b PE=3 SV=2 706 892 2.0E-09
sp|Q9BYM8|HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens GN=RBCK1 PE=1 SV=2 706 890 7.0E-09
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 717 915 2.0E-08
sp|Q08B84|RN19B_XENLA E3 ubiquitin-protein ligase RNF19B OS=Xenopus laevis GN=rnf19b PE=2 SV=2 706 892 3.0E-08
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 717 913 6.0E-08
sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 706 896 1.0E-07
sp|Q80TT8|CUL9_MOUSE Cullin-9 OS=Mus musculus GN=Cul9 PE=1 SV=2 777 913 4.0E-07
sp|Q62921|HOIL1_RAT RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Rattus norvegicus GN=Rbck1 PE=1 SV=3 706 890 1.0E-06
sp|A9JTG5|HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio GN=rbck1 PE=2 SV=1 721 893 1.0E-06
sp|Q5UQ35|YR811_MIMIV Putative ariadne-like RING finger protein R811 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R811 PE=3 SV=1 861 912 5.0E-06
sp|Q04638|ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITT1 PE=1 SV=1 858 912 5.0E-06
sp|Q657B3|C3H7_ORYSJ Zinc finger CCCH domain-containing protein 7 OS=Oryza sativa subsp. japonica GN=Os01g0572100 PE=2 SV=1 12 181 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029810
MVQGTLEKSPQQVCRFYIRGRCTFGNNCKFSHTTPSGDRPANDTSRAEDKIPNTPNSTSSHGVTGSNESKVKPLA
KVNKPCRLWQGGSCKWGDKCRFRHDAEAGSPTVTQGGDATPIPNRVGGTQSVDTSETKVRPAATTQIQERQQPVN
KKGFKFNDQAAAVRRERQKQLDQEREARKEAKEKQRIEQRRKQEEDWAKEATFTIQRVVLNSFVRFEAGLTIQHV
ICGFEASQILIKNLPLNAQRSEIIALFTQQGVDPNDLVILKMETVDGHSQATVLGRATDVGVIAVGLDGIEFRDE
NLEFVVCERTSDGRTMGSSNRDFHLLTISYPKPSLTMVVRYPDIGTFEAGENKRKLDGKILNGQRIRAEVTADGF
DEDYLPSYVIELSRIPADTTVAEVQTLANTRNVELRQNALSYKSDDVFNAIESHLRSLPGSTLQRLTPDNSSRPN
FVSVKAFFNTWESAKSARDSLSGKFLRLGFPSLRVFLSDPYRFVLTLDENQYNSQKAQWSELCEGKRKEVTIQTR
TVDRGRRRSVIITLFGRDKKMVGALKVRIEGMAAGQRLDASYWHPVFKDYKYLEFFDDLYHSTGAYFRSDWKHNR
LTASGSIDAVEAAKARIKDEIDRIAAEQWTIPLQRRALGFFIREGLAKMKGLLGEENVTLDVNSAKIVLHGADLE
EARHHLRQLMDTFMNRNASSSSNTASDENPCPVCYDNVSEPFEIGCQHIYCSSCLRHYILSTFDNHSFPLKCMGN
DATCNQPLSLPLIQRFLPHQRFETLMEAAFRSYIDKNPETFKYCNTPDCSQVYRATTSPQVLQCPSCFAEVCTAC
YNEGHTGMTCAERRVHKDAGEQERLLRQWATKSGVKRCPSCQAWVEKTEGCNHMSCKCGAHFCWICLGVFESNRI
YDHMSKEHGGFYNDPEPRVNAVQAVPNNGPDIVDVVGGPAAAAEQMAAFRRIEAERAYRVQPPANGIVAERPARP
FVNRVPAGVGWGAGQEARRDQPLQAEAERRRREIRDIMEREEARRTAERRREEDRQLALRAQYIRTQRETQQAGR
EEVRRREAEARRRETQENKGWCTIM*
Coding >AgabiH97|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACATTCGGG
AACAATTGCAAGTTTTCTCATACTACGCCGTCAGGCGACAGGCCCGCGAATGATACTAGCCGGGCGGAAGATAAG
ATTCCAAATACGCCGAACTCGACGTCCTCTCATGGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCT
AAAGTTAATAAGCCATGTAGGCTGTGGCAAGGAGGTAGCTGTAAATGGGGAGATAAGTGTCGATTTCGACATGAT
GCTGAGGCTGGGTCGCCTACTGTTACTCAAGGCGGTGATGCTACACCGATTCCTAACCGTGTAGGTGGTACGCAG
TCTGTGGATACTAGTGAGACGAAGGTCCGTCCTGCGGCGACGACCCAAATACAAGAGAGGCAACAACCTGTGAAC
AAGAAAGGGTTCAAATTCAACGACCAAGCAGCGGCAGTCCGCCGGGAAAGGCAAAAACAATTAGACCAAGAAAGG
GAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAG
GCGACCTTCACGATCCAAAGAGTCGTTCTCAACTCGTTTGTTCGATTTGAAGCTGGACTAACCATCCAACACGTT
ATATGCGGTTTCGAAGCATCTCAAATCCTTATCAAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCG
CTCTTCACTCAACAGGGTGTCGATCCTAATGATCTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAG
GCTACTGTTCTGGGAAGAGCGACGGATGTGGGGGTTATTGCTGTGGGTTTGGATGGTATAGAGTTTCGAGATGAG
AATCTCGAATTTGTGGTTTGCGAGAGGACTTCGGATGGTCGTACCATGGGTTCTTCGAATCGAGACTTTCATCTT
CTCACCATATCTTATCCCAAACCATCCCTCACTATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGA
GAAAACAAGAGGAAACTGGACGGAAAAATTCTTAATGGACAGAGGATTCGTGCAGAAGTTACCGCTGATGGTTTT
GATGAAGACTACTTACCTTCTTATGTTATCGAGCTTTCCAGAATACCCGCAGACACCACCGTAGCCGAGGTGCAA
ACCCTTGCTAACACCCGAAATGTCGAACTTCGTCAGAATGCCTTGTCATACAAGTCTGATGATGTGTTCAATGCA
ATAGAATCTCATCTCCGCAGTCTACCTGGATCGACTCTGCAAAGGCTCACCCCTGATAACTCTTCCCGTCCCAAT
TTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAATTT
TTGAGGCTTGGATTTCCTTCCCTTCGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTGGACGAAAAC
CAATATAATTCTCAAAAGGCTCAATGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACAAGG
ACCGTCGATCGAGGTAGAAGAAGAAGTGTCATTATCACTTTATTCGGGCGCGACAAGAAGATGGTAGGTGCCTTG
AAGGTACGCATCGAGGGTATGGCTGCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGATTAC
AAATACCTCGAATTCTTCGACGACCTCTACCATAGCACTGGTGCCTATTTTCGTAGCGATTGGAAACACAACCGC
CTGACAGCGTCGGGTTCTATCGACGCGGTTGAAGCTGCCAAGGCACGTATAAAGGACGAAATTGACCGTATCGCG
GCAGAACAATGGACTATACCGCTTCAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATGAAA
GGACTGCTTGGAGAGGAGAACGTCACACTTGATGTAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTCGAA
GAGGCCAGACACCACCTCAGGCAACTTATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCCAATACAGCT
TCGGATGAAAACCCATGCCCAGTTTGTTACGACAACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATCTAT
TGCTCGTCTTGTCTTCGTCATTATATTCTCTCTACCTTCGATAACCATAGCTTCCCGTTGAAATGCATGGGAAAC
GATGCTACCTGCAACCAACCCCTTTCGCTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACGTTG
ATGGAAGCTGCCTTCCGCTCATATATTGACAAGAATCCCGAGACGTTCAAATACTGTAATACGCCGGATTGCTCT
CAGGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCGTCATGCTTCGCTGAAGTGTGTACAGCATGT
TATAACGAGGGCCATACTGGAATGACTTGCGCAGAAAGGCGTGTTCACAAAGATGCAGGAGAGCAGGAGCGATTG
TTGAGGCAATGGGCAACCAAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAAACCGAAGGG
TGTAATCATATGAGTTGTAAGTGTGGCGCACACTTTTGTTGGATCTGCCTAGGGGTTTTCGAATCTAATCGCATC
TACGACCATATGAGCAAAGAACACGGAGGATTTTATAATGACCCAGAACCGAGGGTTAACGCGGTACAGGCTGTG
CCGAACAATGGGCCAGACATTGTAGATGTTGTGGGTGGACCGGCGGCGGCAGCCGAACAAATGGCAGCGTTCCGT
CGCATTGAAGCAGAACGTGCATACCGAGTCCAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGACCC
TTTGTAAACCGTGTCCCTGCAGGTGTAGGATGGGGTGCGGGACAGGAGGCACGAAGGGATCAGCCACTGCAGGCC
GAAGCTGAACGAAGAAGACGCGAGATACGAGACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGAAGA
CGCGAGGAGGACAGGCAATTGGCATTGAGGGCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGAAGA
GAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGCGACGGGAGACACAAGAGAACAAGGGATGGTGTACGATTATG
TAG
Transcript >AgabiH97|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACATTCGGG
AACAATTGCAAGTTTTCTCATACTACGCCGTCAGGCGACAGGCCCGCGAATGATACTAGCCGGGCGGAAGATAAG
ATTCCAAATACGCCGAACTCGACGTCCTCTCATGGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCT
AAAGTTAATAAGCCATGTAGGCTGTGGCAAGGAGGTAGCTGTAAATGGGGAGATAAGTGTCGATTTCGACATGAT
GCTGAGGCTGGGTCGCCTACTGTTACTCAAGGCGGTGATGCTACACCGATTCCTAACCGTGTAGGTGGTACGCAG
TCTGTGGATACTAGTGAGACGAAGGTCCGTCCTGCGGCGACGACCCAAATACAAGAGAGGCAACAACCTGTGAAC
AAGAAAGGGTTCAAATTCAACGACCAAGCAGCGGCAGTCCGCCGGGAAAGGCAAAAACAATTAGACCAAGAAAGG
GAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAG
GCGACCTTCACGATCCAAAGAGTCGTTCTCAACTCGTTTGTTCGATTTGAAGCTGGACTAACCATCCAACACGTT
ATATGCGGTTTCGAAGCATCTCAAATCCTTATCAAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCG
CTCTTCACTCAACAGGGTGTCGATCCTAATGATCTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAG
GCTACTGTTCTGGGAAGAGCGACGGATGTGGGGGTTATTGCTGTGGGTTTGGATGGTATAGAGTTTCGAGATGAG
AATCTCGAATTTGTGGTTTGCGAGAGGACTTCGGATGGTCGTACCATGGGTTCTTCGAATCGAGACTTTCATCTT
CTCACCATATCTTATCCCAAACCATCCCTCACTATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGA
GAAAACAAGAGGAAACTGGACGGAAAAATTCTTAATGGACAGAGGATTCGTGCAGAAGTTACCGCTGATGGTTTT
GATGAAGACTACTTACCTTCTTATGTTATCGAGCTTTCCAGAATACCCGCAGACACCACCGTAGCCGAGGTGCAA
ACCCTTGCTAACACCCGAAATGTCGAACTTCGTCAGAATGCCTTGTCATACAAGTCTGATGATGTGTTCAATGCA
ATAGAATCTCATCTCCGCAGTCTACCTGGATCGACTCTGCAAAGGCTCACCCCTGATAACTCTTCCCGTCCCAAT
TTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAATTT
TTGAGGCTTGGATTTCCTTCCCTTCGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTGGACGAAAAC
CAATATAATTCTCAAAAGGCTCAATGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACAAGG
ACCGTCGATCGAGGTAGAAGAAGAAGTGTCATTATCACTTTATTCGGGCGCGACAAGAAGATGGTAGGTGCCTTG
AAGGTACGCATCGAGGGTATGGCTGCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGATTAC
AAATACCTCGAATTCTTCGACGACCTCTACCATAGCACTGGTGCCTATTTTCGTAGCGATTGGAAACACAACCGC
CTGACAGCGTCGGGTTCTATCGACGCGGTTGAAGCTGCCAAGGCACGTATAAAGGACGAAATTGACCGTATCGCG
GCAGAACAATGGACTATACCGCTTCAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATGAAA
GGACTGCTTGGAGAGGAGAACGTCACACTTGATGTAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTCGAA
GAGGCCAGACACCACCTCAGGCAACTTATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCCAATACAGCT
TCGGATGAAAACCCATGCCCAGTTTGTTACGACAACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATCTAT
TGCTCGTCTTGTCTTCGTCATTATATTCTCTCTACCTTCGATAACCATAGCTTCCCGTTGAAATGCATGGGAAAC
GATGCTACCTGCAACCAACCCCTTTCGCTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACGTTG
ATGGAAGCTGCCTTCCGCTCATATATTGACAAGAATCCCGAGACGTTCAAATACTGTAATACGCCGGATTGCTCT
CAGGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCGTCATGCTTCGCTGAAGTGTGTACAGCATGT
TATAACGAGGGCCATACTGGAATGACTTGCGCAGAAAGGCGTGTTCACAAAGATGCAGGAGAGCAGGAGCGATTG
TTGAGGCAATGGGCAACCAAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAAACCGAAGGG
TGTAATCATATGAGTTGTAAGTGTGGCGCACACTTTTGTTGGATCTGCCTAGGGGTTTTCGAATCTAATCGCATC
TACGACCATATGAGCAAAGAACACGGAGGATTTTATAATGACCCAGAACCGAGGGTTAACGCGGTACAGGCTGTG
CCGAACAATGGGCCAGACATTGTAGATGTTGTGGGTGGACCGGCGGCGGCAGCCGAACAAATGGCAGCGTTCCGT
CGCATTGAAGCAGAACGTGCATACCGAGTCCAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGACCC
TTTGTAAACCGTGTCCCTGCAGGTGTAGGATGGGGTGCGGGACAGGAGGCACGAAGGGATCAGCCACTGCAGGCC
GAAGCTGAACGAAGAAGACGCGAGATACGAGACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGAAGA
CGCGAGGAGGACAGGCAATTGGCATTGAGGGCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGAAGA
GAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGCGACGGGAGACACAAGAGAACAAGGGATGGTGTACGATTATG
TAG
Gene >AgabiH97|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACATTCGGG
AACAATTGCAAGTTTTCTCATACTGTTTGTTTATTCGCCTTGAACCCTTTCTTGTTGCTCTGCTGATCGTACTTA
GACGCCGTCAGGCGACAGGCCCGCGAATGATACTAGCCGGGCGGAAGATAAGATTCCAAATACGCCGTATGTCTT
TGATTACTTGTATCTGTGAAAGCCCTGGGGATCAATTGTTGATGTTCTTTGTGTCGTTTTTAGGAACTCGACGTC
CTCTCATGGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCTAAAGTTAATAAGCCATGTAGGCTGTG
GCAAGGAGGTAGCTGTAAATGGGGAGATAAGTGTCGATTTCGACATGATGCTGAGGTATGAGGTTCCTGATGACT
CGCTATGAGCGTTTGACTGATAATCTTGGTTGATTTTATTTGTATAGGCTGGGTCGCCTACTGTTACTCAAGGCG
GTGATGCTACACCGATTCCTAACCGTGTAGGTGGTACGCAGTCTGTGGATACTAGTGAGACGAAGGTCCGTCCTG
CGGCGACGACCCAAATACAAGAGAGGCAACAACCTGTGAACAAGAAAGGGTTCAAATTCAACGACCAAGCAGCGG
CAGTCCGCCGGGAAAGGCAAAAACAATTAGACCAAGAAAGGGAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAA
TTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAGGCGACCTTCACGATCCAAAGAGTCGTTCTCAACT
CGTTTGTTCGATTTGAAGCTGGACTAACCATCCAACACGTTATATGCGGTTTCGAAGCATCTCAAATCCTTATCA
AGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCGCTCTTCACTCAACAGGGTGTCGATCCTAATGATC
TTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAGGCTACTGTTCTGGGAAGAGCGACGGATGTGGGGG
TTATTGCTGTGGGTTTGGATGGTATAGAGTTTCGAGATGAGAATCTCGAATTTGTGGTTTGCGAGAGGACTTCGG
ATGGTCGTACCATGGGTTCTTCGAATCGAGACTTTCATCTTCTCACCATATCTTATCCCAAACCATCCCTCACTA
TGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGAGAAAACAAGAGGAAACTGGACGGAAAAATTCTTA
ATGGACAGAGGATTCGTGCAGAAGTTACCGCTGATGGTTTTGATGAAGACTACTTACCTTCTTATGTTATCGAGC
TTTCCAGAATACCCGCAGACACCACCGTAGCCGAGGTGCAAACCCTTGCTAACACCCGAAATGTCGAACTTCGTC
AGAATGCCTTGTCATACAAGTCTGATGATGTGTTCAATGCAATAGAATCTCATCTCCGCAGTCTACCTGGATCGA
CTCTGCAAAGGCTCACCCCTGATAACTCTTCCCGTCCCAATTTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGG
AAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAATTTTTGAGGCTTGGATTTCCTTCCCTTCGTGTCTTTC
TATCCGACCCCTATCGATTCGTACTCACTCTGGACGAAAACCAATATAATTCTCAAAAGGCTCAATGGTCTGAAT
TATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACAAGGACCGTCGATCGAGGTAGAAGAAGAAGTGTCATTA
TCACTTTATTCGGGCGCGACAAGAAGATGGTAGGTGCCTTGAAGGTACGCATCGAGGGTATGGCTGCTGGCCAGA
GGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGATTACAAATACCTCGAATTCTTCGACGACCTCTACCATA
GCACTGGTGCCTATTTTCGTAGCGATTGGAAACACAACCGCCTGACAGCGTCGGGTTCTATCGACGCGGTTGAAG
CTGCCAAGGCACGTATAAAGGACGAAATTGACCGTATCGCGGCAGAACAATGGACTATACCGCTTCAACGTCGTG
CTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATGAAAGGACTGCTTGGAGAGGAGAACGTCACACTTGATG
TAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTCGAAGAGGCCAGACACCACCTCAGGCAACTTATGGACA
CTTTCATGAATCGGAATGCGTCGTCATCATCCAATACAGCTTCGGATGAAAACCCATGCCCAGTTTGTTACGACA
ACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATCTATTGCTCGTCTTGTCTTCGTCATTATATTCTCTCTA
CCTTCGATAACCATAGCTTCCCGTTGAAATGCATGGGAAACGATGCTACCTGCAACCAACCCCTTTCGCTTCCTC
TCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACGTTGATGGAAGCTGCCTTCCGCTCATATATTGACAAGA
ATCCCGAGACGTTCAAATACTGTAATACGCCGGATTGCTCTCAGGTATATCGCGCTACCACTTCCCCTCAAGTAC
TACAGTGTCCGTCATGCTTCGCTGAAGTGTGTACAGCATGTTATAACGAGGGCCATACTGGAATGACTTGCGCAG
AAAGGCGTGTTCACAAAGATGCAGGAGAGCAGGAGCGATTGTTGAGGCAATGGGCAACCAAAAGTGGTGTCAAGA
GATGTCCGTCTTGTCAAGCGTGGGTCGAGAAAACCGAAGGGTGTAATCATATGAGTTGTAAGTGTGGCGCACACT
TTTGTTGGATCTGCCTAGGGGTTTTCGAATCTAATCGCATCTACGACCATATGAGCAAAGAACACGGAGGATTTT
ATAATGACCCAGAACCGAGGGTTAACGCGGTACAGGCTGTGCCGAACAATGGGCCAGACATTGTAGATGTTGTGG
GTGGACCGGCGGCGGCAGCCGAACAAATGGCAGCGTTCCGTCGCATTGAAGCAGAACGTGCATACCGAGTCCAAC
CACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGACCCTTTGTAAACCGTGTCCCTGCAGGTGTAGGATGGG
GTGCGGGACAGGAGGCACGAAGGGATCAGCCACTGCAGGCCGAAGCTGAACGAAGAAGACGCGAGATACGAGACA
TTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGAAGACGCGAGGAGGACAGGCAATTGGCATTGAGGGCGC
AGTATATACGGACACAACGTGAGACCCAACAGGCAGGAAGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGC
GACGGGAGACACAAGAGAACAAGGGATGGTGTACGATTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail