Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029790
Gene name
Locationscaffold_12:439839..443361
Strand-
Gene length (bp)3522
Transcript length (bp)3153
Coding sequence length (bp)3153
Protein length (aa) 1051

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18044 zf-CCCH_4 CCCH-type zinc finger 3.9E-07 12 32
PF18044 zf-CCCH_4 CCCH-type zinc finger 1.7E-07 77 97
PF13445 zf-RING_UBOX RING-type zinc-finger 2.9E-05 657 685
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.8E-05 657 690

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 608 824 9.0E-19
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 608 824 2.0E-17
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 609 805 5.0E-06

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029790
MVQGTSEKSPQRVCRYYIKGSCRYGNSCWFLHTAPSSCNVGDRATIDSQSEDRSCSNAMSSSSDNSGSKHLSKVD
EPCRRWQAGSCWWGDNCRFRHDAEVEAGRVGETQFADTNEMNVCPATTDDSEGEEHQEAKEMERIERCRKQEEDW
AEDATVTIQKMVLDSFVQFEAGLTIQRVICGFEASQILIKNLPLDAQGSEIIAFFTQQGVDSNDLAILRMDTVDD
HLQATVLGRAKDVEDVAVGLDGIEFRDRKLEFVVCERNLDGCTTGSSHRNFHFLNISFPKPFLSMIVRYPALQLY
KAEESWRELNGKILNGQRIRAELIVDGFDKDSFLPSHAIELSRIPADTTVAEIQTFANTQNVELGRSITSDEVLN
ALESHLRSLPESTFQRFTPDNSSRPQFISVKAFFDTWESANSAHNSLSGRFLRPGFPPLRLSLSAPYRFVLTMDE
NQYNSQKAQWLELCEGKSKEVTILTRTVDRGRRRRVIITLFGRDKQMVGALKVRIKSMAIGQKLDASYWHPIFKD
FKYLEFFDDLYRSTGAYVHNDWKHNCLTVSGPADAAEAAKNRIKEEMKRISTEQWTIPLQRQALGFFIREGLAKM
KGLLGEENVTLDVKTGNIVLHGADLEEARHHLKQLLISFSNQNASSSSNTASEENPCPVCYDNVSDPFEIGCQHV
YCSSCLRHYILSTFDNHSFPLKCMGSDATCNQPLSLPLIQRFLPRTRFEELMEAAFRSYIDKNPETFKYCNTPDC
SQVYRATTSPQVLQCPSCFAEKDVGEQERLLRRWATESGVKRCPSCQAWVEKSAGWVFESDRIYDHMSKEHGGFY
NDPEPRVNAGQAVPNNEPDIVDIVGGPAAAAEQMAAFRRIEAGRVYRVQPPANRFWADRPARPPANRMPLAEERV
AEHEALRDQPLQAEARRREAVEQRREEDRQEALRAQRMQVERDLEQTREREEAMRREVEERRREEGRQEAIMAQR
IQIEREHEQAREREEVKRREVEERRREEDRQEALQAQHLQTEFERELPQNTRTRKEKKGRGAEARRMRNKGCMIM
*
Coding >AgabiH97|029790
ATGGTTCAAGGAACGTCGGAGAAATCACCTCAACGAGTCTGCAGATATTATATCAAAGGGAGCTGTCGATATGGG
AACAGCTGCTGGTTTCTTCATACTGCGCCATCGTCATGCAATGTAGGTGACAGGGCGACGATTGACAGCCAATCG
GAAGATAGGTCTTGTTCAAATGCAATGAGCTCAAGTTCAGATAATTCAGGAAGTAAGCACCTTAGCAAGGTGGAT
GAGCCTTGTAGGCGGTGGCAAGCAGGTAGTTGTTGGTGGGGAGATAATTGTCGTTTTCGGCATGATGCTGAGGTG
GAGGCTGGTCGTGTAGGCGAGACACAATTTGCAGATACTAATGAGATGAATGTTTGTCCTGCCACTACCGACGAT
TCCGAGGGGGAAGAACATCAAGAGGCGAAAGAAATGGAAAGGATTGAACGATGCCGTAAGCAAGAGGAAGACTGG
GCTGAAGATGCGACTGTCACGATCCAAAAAATGGTCCTCGACTCATTTGTTCAATTTGAAGCTGGTTTAACCATT
CAACGCGTCATATGCGGTTTCGAAGCATCTCAAATCCTTATAAAAAACCTTCCTTTGGATGCACAGGGATCCGAG
ATCATTGCGTTCTTCACTCAACAAGGTGTTGATTCTAATGACCTTGCCATACTCAGAATGGATACTGTGGATGAT
CATTTACAGGCTACTGTGCTGGGAAGAGCGAAGGATGTAGAGGATGTTGCAGTAGGTTTGGATGGGATAGAGTTT
CGGGATAGAAAACTTGAGTTCGTCGTTTGCGAGAGGAACTTGGATGGTTGTACGACGGGGTCATCGCATCGGAAC
TTTCATTTTCTCAACATATCTTTTCCTAAACCGTTCCTCAGTATGATTGTCCGGTATCCCGCCCTCCAATTATAC
AAGGCTGAAGAGAGTTGGAGGGAGTTGAATGGAAAGATTCTCAATGGACAAAGGATTCGTGCAGAACTTATAGTT
GATGGTTTTGATAAAGACTCTTTCTTACCTTCTCATGCTATCGAGCTTTCCAGAATACCTGCAGACACCACCGTA
GCCGAGATCCAAACTTTCGCCAACACCCAGAATGTCGAACTGGGTCGTAGCATCACGTCGGATGAAGTACTCAAC
GCACTAGAGTCTCATCTTCGCAGTTTACCTGAATCCACCTTTCAAAGATTTACCCCTGACAACTCTTCTCGTCCC
CAATTCATTTCTGTCAAAGCCTTTTTTGACACTTGGGAAAGCGCAAATTCCGCTCACAACAGTCTTTCCGGAAGA
TTCTTGAGGCCTGGATTTCCTCCGCTCCGTCTCTCCCTATCGGCACCCTATCGATTTGTGCTCACTATGGACGAA
AACCAGTATAATTCTCAAAAGGCGCAATGGTTAGAGTTATGTGAGGGAAAGAGCAAGGAGGTGACTATCCTGACG
AGGACCGTTGATCGAGGTAGAAGAAGGAGAGTGATTATCACTTTGTTCGGGCGCGATAAGCAGATGGTAGGTGCC
TTGAAGGTACGTATCAAGAGTATGGCTATTGGCCAGAAACTTGATGCGTCCTATTGGCACCCCATATTCAAGGAT
TTCAAGTATCTCGAATTTTTCGACGATCTCTACCGTAGCACTGGAGCCTACGTTCATAACGATTGGAAGCATAAC
TGCCTCACAGTGTCAGGTCCAGCCGATGCGGCTGAAGCTGCCAAAAATCGTATAAAGGAAGAAATGAAACGTATC
TCGACAGAACAATGGACTATACCGCTTCAACGTCAAGCTTTAGGATTCTTCATCCGCGAGGGTCTGGCGAAGATG
AAAGGGTTACTTGGAGAGGAGAACGTCACTCTTGATGTCAAGACCGGGAATATTGTGCTCCATGGTGCCGACCTT
GAAGAGGCCAGACACCACCTCAAACAACTCTTGATCTCGTTCTCGAATCAAAATGCATCATCATCATCCAATACG
GCCTCGGAAGAAAATCCATGCCCAGTTTGTTACGACAACGTCTCAGACCCTTTCGAGATCGGGTGTCAACATGTC
TATTGCTCTTCTTGTCTTCGCCATTATATTCTCTCTACCTTCGACAACCATAGCTTTCCGTTGAAATGCATGGGA
AGCGATGCTACCTGCAACCAACCCCTTTCACTACCTCTCATCCAGAGATTCTTACCTCGCACGCGATTTGAGGAA
TTGATGGAAGCTGCGTTTCGCTCATACATCGACAAGAACCCCGAGACGTTCAAATATTGTAACACGCCGGATTGC
TCACAAGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCCTCGTGCTTCGCCGAAAAGGATGTTGGA
GAACAAGAACGACTACTGAGGCGATGGGCAACTGAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTC
GAGAAGAGCGCCGGGTGGGTTTTCGAGTCGGATCGCATCTACGACCATATGAGCAAAGAGCACGGAGGATTTTAT
AATGATCCAGAACCGAGGGTTAACGCGGGACAAGCCGTGCCGAACAATGAACCAGACATTGTAGATATTGTGGGT
GGGCCGGCGGCGGCGGCAGAACAAATGGCCGCGTTTCGTCGCATTGAAGCAGGACGTGTATACCGAGTCCAACCA
CCAGCCAATAGGTTTTGGGCCGATCGTCCAGCTAGACCCCCTGCAAACCGGATGCCCTTAGCTGAGGAGCGAGTT
GCGGAGCACGAGGCACTAAGGGATCAGCCACTGCAGGCCGAAGCTAGGAGGAGAGAAGCAGTGGAACAAAGACGC
GAGGAGGACAGACAAGAGGCATTGAGGGCTCAGCGTATGCAGGTAGAACGTGATCTTGAACAGACGAGGGAAAGG
GAAGAAGCTATGAGAAGAGAAGTGGAGGAACGGAGGCGTGAGGAAGGCAGACAGGAAGCAATAATGGCTCAGCGT
ATACAAATAGAACGTGAGCATGAACAGGCGAGGGAAAGAGAAGAAGTTAAGAGGAGAGAAGTGGAGGAACGGAGG
CGTGAGGAGGACAGACAAGAAGCATTACAGGCTCAACATTTACAGACAGAATTTGAGCGCGAACTGCCACAGAAC
ACGAGGACAAGGAAAGAAAAAAAAGGCAGGGGAGCGGAAGCTCGAAGAATGAGAAACAAGGGATGTATGATTATG
TAG
Transcript >AgabiH97|029790
ATGGTTCAAGGAACGTCGGAGAAATCACCTCAACGAGTCTGCAGATATTATATCAAAGGGAGCTGTCGATATGGG
AACAGCTGCTGGTTTCTTCATACTGCGCCATCGTCATGCAATGTAGGTGACAGGGCGACGATTGACAGCCAATCG
GAAGATAGGTCTTGTTCAAATGCAATGAGCTCAAGTTCAGATAATTCAGGAAGTAAGCACCTTAGCAAGGTGGAT
GAGCCTTGTAGGCGGTGGCAAGCAGGTAGTTGTTGGTGGGGAGATAATTGTCGTTTTCGGCATGATGCTGAGGTG
GAGGCTGGTCGTGTAGGCGAGACACAATTTGCAGATACTAATGAGATGAATGTTTGTCCTGCCACTACCGACGAT
TCCGAGGGGGAAGAACATCAAGAGGCGAAAGAAATGGAAAGGATTGAACGATGCCGTAAGCAAGAGGAAGACTGG
GCTGAAGATGCGACTGTCACGATCCAAAAAATGGTCCTCGACTCATTTGTTCAATTTGAAGCTGGTTTAACCATT
CAACGCGTCATATGCGGTTTCGAAGCATCTCAAATCCTTATAAAAAACCTTCCTTTGGATGCACAGGGATCCGAG
ATCATTGCGTTCTTCACTCAACAAGGTGTTGATTCTAATGACCTTGCCATACTCAGAATGGATACTGTGGATGAT
CATTTACAGGCTACTGTGCTGGGAAGAGCGAAGGATGTAGAGGATGTTGCAGTAGGTTTGGATGGGATAGAGTTT
CGGGATAGAAAACTTGAGTTCGTCGTTTGCGAGAGGAACTTGGATGGTTGTACGACGGGGTCATCGCATCGGAAC
TTTCATTTTCTCAACATATCTTTTCCTAAACCGTTCCTCAGTATGATTGTCCGGTATCCCGCCCTCCAATTATAC
AAGGCTGAAGAGAGTTGGAGGGAGTTGAATGGAAAGATTCTCAATGGACAAAGGATTCGTGCAGAACTTATAGTT
GATGGTTTTGATAAAGACTCTTTCTTACCTTCTCATGCTATCGAGCTTTCCAGAATACCTGCAGACACCACCGTA
GCCGAGATCCAAACTTTCGCCAACACCCAGAATGTCGAACTGGGTCGTAGCATCACGTCGGATGAAGTACTCAAC
GCACTAGAGTCTCATCTTCGCAGTTTACCTGAATCCACCTTTCAAAGATTTACCCCTGACAACTCTTCTCGTCCC
CAATTCATTTCTGTCAAAGCCTTTTTTGACACTTGGGAAAGCGCAAATTCCGCTCACAACAGTCTTTCCGGAAGA
TTCTTGAGGCCTGGATTTCCTCCGCTCCGTCTCTCCCTATCGGCACCCTATCGATTTGTGCTCACTATGGACGAA
AACCAGTATAATTCTCAAAAGGCGCAATGGTTAGAGTTATGTGAGGGAAAGAGCAAGGAGGTGACTATCCTGACG
AGGACCGTTGATCGAGGTAGAAGAAGGAGAGTGATTATCACTTTGTTCGGGCGCGATAAGCAGATGGTAGGTGCC
TTGAAGGTACGTATCAAGAGTATGGCTATTGGCCAGAAACTTGATGCGTCCTATTGGCACCCCATATTCAAGGAT
TTCAAGTATCTCGAATTTTTCGACGATCTCTACCGTAGCACTGGAGCCTACGTTCATAACGATTGGAAGCATAAC
TGCCTCACAGTGTCAGGTCCAGCCGATGCGGCTGAAGCTGCCAAAAATCGTATAAAGGAAGAAATGAAACGTATC
TCGACAGAACAATGGACTATACCGCTTCAACGTCAAGCTTTAGGATTCTTCATCCGCGAGGGTCTGGCGAAGATG
AAAGGGTTACTTGGAGAGGAGAACGTCACTCTTGATGTCAAGACCGGGAATATTGTGCTCCATGGTGCCGACCTT
GAAGAGGCCAGACACCACCTCAAACAACTCTTGATCTCGTTCTCGAATCAAAATGCATCATCATCATCCAATACG
GCCTCGGAAGAAAATCCATGCCCAGTTTGTTACGACAACGTCTCAGACCCTTTCGAGATCGGGTGTCAACATGTC
TATTGCTCTTCTTGTCTTCGCCATTATATTCTCTCTACCTTCGACAACCATAGCTTTCCGTTGAAATGCATGGGA
AGCGATGCTACCTGCAACCAACCCCTTTCACTACCTCTCATCCAGAGATTCTTACCTCGCACGCGATTTGAGGAA
TTGATGGAAGCTGCGTTTCGCTCATACATCGACAAGAACCCCGAGACGTTCAAATATTGTAACACGCCGGATTGC
TCACAAGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCCTCGTGCTTCGCCGAAAAGGATGTTGGA
GAACAAGAACGACTACTGAGGCGATGGGCAACTGAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTC
GAGAAGAGCGCCGGGTGGGTTTTCGAGTCGGATCGCATCTACGACCATATGAGCAAAGAGCACGGAGGATTTTAT
AATGATCCAGAACCGAGGGTTAACGCGGGACAAGCCGTGCCGAACAATGAACCAGACATTGTAGATATTGTGGGT
GGGCCGGCGGCGGCGGCAGAACAAATGGCCGCGTTTCGTCGCATTGAAGCAGGACGTGTATACCGAGTCCAACCA
CCAGCCAATAGGTTTTGGGCCGATCGTCCAGCTAGACCCCCTGCAAACCGGATGCCCTTAGCTGAGGAGCGAGTT
GCGGAGCACGAGGCACTAAGGGATCAGCCACTGCAGGCCGAAGCTAGGAGGAGAGAAGCAGTGGAACAAAGACGC
GAGGAGGACAGACAAGAGGCATTGAGGGCTCAGCGTATGCAGGTAGAACGTGATCTTGAACAGACGAGGGAAAGG
GAAGAAGCTATGAGAAGAGAAGTGGAGGAACGGAGGCGTGAGGAAGGCAGACAGGAAGCAATAATGGCTCAGCGT
ATACAAATAGAACGTGAGCATGAACAGGCGAGGGAAAGAGAAGAAGTTAAGAGGAGAGAAGTGGAGGAACGGAGG
CGTGAGGAGGACAGACAAGAAGCATTACAGGCTCAACATTTACAGACAGAATTTGAGCGCGAACTGCCACAGAAC
ACGAGGACAAGGAAAGAAAAAAAAGGCAGGGGAGCGGAAGCTCGAAGAATGAGAAACAAGGGATGTATGATTATG
TAG
Gene >AgabiH97|029790
ATGGTTCAAGGAACGTCGGAGAAATCACCTCAACGAGTCTGCAGATATTATATCAAAGGGAGCTGTCGATATGGG
AACAGCTGCTGGTTTCTTCATACTGTCCGTTGATCGTTTTATCGCCCGTCCGCCTCTGCTGACCGTATCGATTTC
GGTGAATCACCTTAGGCGCCATCGTCATGCAATGTAGGTGACAGGGCGACGATTGACAGCCAATCGGAAGATAGG
TCTTGTTCAAATGCAATGTATGTTCTCCGTTAAATTGTATCTTTGACTTGAACCTCTCAATGAATCGTCAATGTC
TTTGTTGTTATAGGAGCTCAAGTTCAGATAATTCAGGAAGTAAGCACCTTAGCAAGGTGGATGAGCCTTGTAGGC
GGTGGCAAGCAGGTAGTTGTTGGTGGGGAGATAATTGTCGTTTTCGGCATGATGCTGAGGTGGAGGTAAATTTCC
GTTACTATGTACTATGTGCCCTTTTTCTGATAATCCTTTTTGTTTTTGTCAATTTTACAGGCTGGTCGTGTAGGC
GAGACACAATTTGCAGATACTAATGAGATGAATGTTTGTCCTGCCACTACCGACGATTCCGAGGGGGAAGAACAT
CAAGAGGCGAAAGAAATGGAAAGGATTGAACGATGCCGTAAGCAAGAGGAAGACTGGGCTGAAGATGCGACTGTC
ACGATCCAAAAAATGGTCCTCGACTCATTTGTTCAATTTGAAGCTGGTTTAACCATTCAACGCGTCATATGCGGT
TTCGAAGCATCTCAAATCCTTATAAAAAACCTTCCTTTGGATGCACAGGGATCCGAGATCATTGCGTTCTTCACT
CAACAAGGTGTTGATTCTAATGACCTTGCCATACTCAGAATGGATACTGTGGATGATCATTTACAGGCTACTGTG
CTGGGAAGAGCGAAGGATGTAGAGGATGTTGCAGTAGGTTTGGATGGGATAGAGTTTCGGGATAGAAAACTTGAG
TTCGTCGTTTGCGAGAGGAACTTGGATGGTTGTACGACGGGGTCATCGCATCGGAACTTTCATTTTCTCAACATA
TCTTTTCCTAAACCGTTCCTCAGTATGATTGTCCGGTATCCCGCCCTCCAATTATACAAGGCTGAAGAGAGTTGG
AGGGAGTTGAATGGAAAGATTCTCAATGGACAAAGGATTCGTGCAGAACTTATAGTTGATGGTTTTGATAAAGAC
TCTTTCTTACCTTCTCATGCTATCGAGCTTTCCAGAATACCTGCAGACACCACCGTAGCCGAGATCCAAACTTTC
GCCAACACCCAGAATGTCGAACTGGGTCGTAGCATCACGTCGGATGAAGTACTCAACGCACTAGAGTCTCATCTT
CGCAGTTTACCTGAATCCACCTTTCAAAGATTTACCCCTGACAACTCTTCTCGTCCCCAATTCATTTCTGTCAAA
GCCTTTTTTGACACTTGGGAAAGCGCAAATTCCGCTCACAACAGTCTTTCCGGAAGATTCTTGAGGCCTGGATTT
CCTCCGCTCCGTCTCTCCCTATCGGCACCCTATCGATTTGTGCTCACTATGGACGAAAACCAGTATAATTCTCAA
AAGGCGCAATGGTTAGAGTTATGTGAGGGAAAGAGCAAGGAGGTGACTATCCTGACGAGGACCGTTGATCGAGGT
AGAAGAAGGAGAGTGATTATCACTTTGTTCGGGCGCGATAAGCAGATGGTAGGTGCCTTGAAGGTACGTATCAAG
AGTATGGCTATTGGCCAGAAACTTGATGCGTCCTATTGGCACCCCATATTCAAGGATTTCAAGTATCTCGAATTT
TTCGACGATCTCTACCGTAGCACTGGAGCCTACGTTCATAACGATTGGAAGCATAACTGCCTCACAGTGTCAGGT
CCAGCCGATGCGGCTGAAGCTGCCAAAAATCGTATAAAGGAAGAAATGAAACGTATCTCGACAGAACAATGGACT
ATACCGCTTCAACGTCAAGCTTTAGGATTCTTCATCCGCGAGGGTCTGGCGAAGATGAAAGGGTTACTTGGAGAG
GAGAACGTCACTCTTGATGTCAAGACCGGGAATATTGTGCTCCATGGTGCCGACCTTGAAGAGGCCAGACACCAC
CTCAAACAACTCTTGATCTCGTTCTCGAATCAAAATGCATCATCATCATCCAATACGGCCTCGGAAGAAAATCCA
TGCCCAGTTTGTTACGACAACGTCTCAGACCCTTTCGAGATCGGGTGTCAACATGTCTATTGCTCTTCTTGTCTT
CGCCATTATATTCTCTCTACCTTCGACAACCATAGCTTTCCGTTGAAATGCATGGGAAGCGATGCTACCTGCAAC
CAACCCCTTTCACTACCTCTCATCCAGAGATTCTTACCTCGCACGCGATTTGAGGAATTGATGGAAGCTGCGTTT
CGCTCATACATCGACAAGAACCCCGAGACGTTCAAATATTGTAACACGCCGGATTGCTCACAAGTATATCGCGCT
ACCACTTCCCCTCAAGTACTACAGTGTCCCTCGTGCTTCGCCGAAGTGTGTACGGCATGTCATAACGAGGGCCAT
ACTGGAATAACTTGTGCTCAAAGGCTCGCCCAGAAGGATGTTGGAGAACAAGAACGACTACTGAGGCGATGGGCA
ACTGAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAGAGCGCCGGGTGTAATCATATGGGT
TGTAAGTGTGGCGCACACTTTTGTTGGATCTGTCTAGGGGTTTTCGAGTCGGATCGCATCTACGACCATATGAGC
AAAGAGCACGGAGGATTTTATAATGATCCAGAACCGAGGGTTAACGCGGGACAAGCCGTGCCGAACAATGAACCA
GACATTGTAGATATTGTGGGTGGGCCGGCGGCGGCGGCAGAACAAATGGCCGCGTTTCGTCGCATTGAAGCAGGA
CGTGTATACCGAGTCCAACCACCAGCCAATAGGTTTTGGGCCGATCGTCCAGCTAGACCCCCTGCAAACCGGATG
CCCTTAGCTGAGGAGCGAGTTGCGGAGCACGAGGCACTAAGGGATCAGCCACTGCAGGCCGAAGGTGAACAAATT
TGGCGCGAGATAAGAAACTTTGCTGAAAGAGATCAAGCTAGGAGGAGAGAAGCAGTGGAACAAAGACGCGAGGAG
GACAGACAAGAGGCATTGAGGGCTCAGCGTATGCAGGTAGAACGTGATCTTGAACAGACGAGGGAAAGGGAAGAA
GCTATGAGAAGAGAAGTGGAGGAACGGAGGCGTGAGGAAGGCAGACAGGAAGCAATAATGGCTCAGCGTATACAA
ATAGAACGTGAGCATGAACAGGCGAGGGAAAGAGAAGAAGTTAAGAGGAGAGAAGTGGAGGAACGGAGGCGTGAG
GAGGACAGACAAGAAGCATTACAGGCTCAACATTTACAGACAGAATTTGAGCGCGAACTGCCACAGAACACGAGG
ACAAGGAAAGAAAAAAAAGGCAGGGGAGCGGAAGCTCGAAGAATGAGAAACAAGGGATGTATGATTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail