Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029610
Gene name
Locationscaffold_12:395787..396801
Strand+
Gene length (bp)1014
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O77666|TRI26_PIG Tripartite motif-containing protein 26 OS=Sus scrofa GN=TRIM26 PE=3 SV=2 30 70 4.0E-06
sp|P62603|TRI26_RAT Tripartite motif-containing protein 26 OS=Rattus norvegicus GN=Trim26 PE=3 SV=1 30 70 5.0E-06
sp|Q99PN3|TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus GN=Trim26 PE=2 SV=3 30 70 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029610
MLGPVSFPRSPLSCCASTLILLIPSFPLCPCSIQCGHIFCYECLNRIEPASSDPSPVCPLCRQPYDKHYIIKLHL
DTDNPRPSSANQAEQEAKRLQGKMTNLINNGASEPAIRGLLDECQKFIHSQPRNLFSDLRLSHRVMAYLVDVRSD
LFSQKQVCSDLNNQVEQLGKEKAELERRLKDMKVKRRAFRKLI*
Coding >AgabiH97|029610
ATGTTAGGACCCGTGTCCTTTCCTCGCTCCCCCCTTTCTTGTTGTGCATCCACACTGATTCTCCTTATACCCTCC
TTTCCCCTGTGCCCTTGTTCGATACAATGTGGTCACATTTTCTGTTATGAGTGTCTTAATCGCATAGAGCCCGCA
TCCTCAGATCCTTCTCCAGTATGTCCTCTGTGTCGGCAACCCTACGACAAACACTACATTATCAAGCTTCATCTG
GATACGGACAATCCTCGACCCTCTAGTGCCAATCAAGCAGAGCAAGAGGCGAAAAGGCTTCAGGGGAAGATGACG
AACTTGATTAATAATGGCGCATCCGAACCGGCGATCAGGGGACTACTTGACGAGTGTCAGAAATTCATCCATAGT
CAACCGCGCAACTTGTTTTCAGACTTGCGACTGTCACACAGGGTGATGGCATATCTGGTCGATGTGAGATCGGAT
CTGTTTTCCCAGAAGCAGGTTTGTAGTGATCTGAACAATCAAGTCGAGCAGCTGGGGAAAGAGAAAGCGGAACTC
GAAAGGCGTTTGAAGGACATGAAGGTAAAGCGCAGAGCGTTCAGGAAATTAATATAA
Transcript >AgabiH97|029610
ATGTTAGGACCCGTGTCCTTTCCTCGCTCCCCCCTTTCTTGTTGTGCATCCACACTGATTCTCCTTATACCCTCC
TTTCCCCTGTGCCCTTGTTCGATACAATGTGGTCACATTTTCTGTTATGAGTGTCTTAATCGCATAGAGCCCGCA
TCCTCAGATCCTTCTCCAGTATGTCCTCTGTGTCGGCAACCCTACGACAAACACTACATTATCAAGCTTCATCTG
GATACGGACAATCCTCGACCCTCTAGTGCCAATCAAGCAGAGCAAGAGGCGAAAAGGCTTCAGGGGAAGATGACG
AACTTGATTAATAATGGCGCATCCGAACCGGCGATCAGGGGACTACTTGACGAGTGTCAGAAATTCATCCATAGT
CAACCGCGCAACTTGTTTTCAGACTTGCGACTGTCACACAGGGTGATGGCATATCTGGTCGATGTGAGATCGGAT
CTGTTTTCCCAGAAGCAGGTTTGTAGTGATCTGAACAATCAAGTCGAGCAGCTGGGGAAAGAGAAAGCGGAACTC
GAAAGGCGTTTGAAGGACATGAAGGTAAAGCGCAGAGCGTTCAGGAAATTAATATAA
Gene >AgabiH97|029610
ATGTTAGGACCCGTGTCCTTTCCTCGCTCCCCCCTTTCTTGTTGTGCATCCACACTGATTCTCCTTATACCCTGT
GGGCTGTTTCTTTGGACCCTCCCCTTTCAATACCCCTAATCTGTTTACTGTCTTCACCGTCGTTCTTTACCTGGA
AATCTATGCCTATTAGCCTTTCCCCTGGTTCAACATGCGACATCTGCACGGAACCATTTGACGGGACTTCTCTAC
TAAAGTGCCCTTGTTCGATACAATGTGGTCACATTTTCTGTTATGAGTGGGTGCAATCACGACTAGCTCCACCCT
TTCTCATATCCACCCCTCTCGCGGCTCCAGGTGTCTTAATCGCATAGAGCCCGCATCCTCAGATCCTTCTCCAGT
ATGTCCTCTGTGTCGGCAACCCTACGACAAACACTACATTATCAAGCTTCATCTGGATACGGACAATCCTCGACC
CTCTAGTGCCAATCAAGCAGAGCAAGAGGCGAAAAGGCTTCAGGGGAAGATGACGAACTTGATTAATAATGGCGC
ATCCGAACCGGCGATCAGGGGACTACTTGACGAGTGTCAGAAATTCATCCATAGTCAACCGCGCAACTTGGTACG
AGGTCCTGTAAGCTATCGAACTTTATTGATCATTCTCTCAGTTTTCAGACTTGCGACTGTCACACAGGGTGATGG
CATATCTGGTCGATGTGAGATCGGATCTGTTTTCCCAGAAGCAGGTTTGTAGTGATCTGAACAATCAAGTCGAGC
AGCTGGGGAAAGAGAAAGCGGAACTCGAAAGGCGTTTGAAGGACATGAAGGTAAAGCGCAGAGCGTTCAGGAAAT
GTGCGGAAGAGAGAGAGTCCGTCCTCAGAGATCACTGCGAACGAGCTCATGCAGCTTATGAGACCATTGTCAAGT
AAGTATCACATATTCCCAATCCAACTTCCCTGATTTAATCTGATAACTTTACTTTTAGCCAAGTGAGTATTCGGT
CTATGCGTCAGCCAGCAAAAGCCTCATTTTTTAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail