Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029430
Gene name
Locationscaffold_12:344520..345698
Strand-
Gene length (bp)1178
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88 9.1E-29 51 233

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34559|URHG2_BACSU Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) GN=yteR PE=1 SV=1 54 233 4.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 2.22 0.43 4.01
Initials Initials knots 2.36 0.65 4.06
Pileal_Stipeal_center Stage I stipe center 0.67 0.03 1.31
Pileal_Stipeal_shell Stage I stipe shell 0.75 0.04 1.47
DIF_stipe_center Stage II stipe center 0.59 0.00 1.19
DIF_stipe_shell Stage II stipe shell 0.62 0.01 1.24
DIF_stipe_skin Stage II stipe skin 0.88 0.09 1.67
DIF_cap_skin Stage II cap skin 0.69 0.01 1.37
DIF_cap_tissue Stage II cap tissue 0.88 0.04 1.72
DIF_gill_tissue Stage II gill tissue 1.09 0.09 2.09
YFB_stipe_center Young fruiting body stipe center 0.91 0.12 1.70
YFB_stipe_shell Young fruiting body stipe shell 0.61 0.00 1.22
YFB_stipe_skin Young fruiting body stipe skin 0.86 0.09 1.62
YFB_cap_skin Young fruiting body cap skin 0.16 0.00 0.42
YFB_cap_tissue Young fruiting body cap tissue 0.40 0.00 0.86
YFB_gill_tissue Young fruiting body gill tissue 0.36 0.00 0.79
YFB_veil Young fruiting body veil 0.62 0.00 1.26

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.308631 no
Casing YFB_stipe_center 0.138986 no
Casing YFB_stipe_shell 0.042692 yes
Casing YFB_stipe_skin 0.138008 no
Casing YFB_cap_skin 0.063760 no
Casing YFB_cap_tissue 0.021322 yes
Casing YFB_gill_tissue 0.027943 yes
Casing YFB_veil 0.046745 yes
Casing Initials 0.953169 no
Casing Pileal_Stipeal_center 0.057155 no
Casing Pileal_Stipeal_shell 0.085045 no
Casing DIF_stipe_center 0.050085 no
Casing DIF_stipe_shell 0.042909 yes
Casing DIF_stipe_skin 0.149346 no
Casing DIF_cap_skin 0.069952 no
Casing DIF_cap_tissue 0.170359 no
DIF_gill_tissue YFB_stipe_center 0.870356 no
DIF_gill_tissue YFB_stipe_shell 0.482755 no
DIF_gill_tissue YFB_stipe_skin 0.828443 no
DIF_gill_tissue YFB_cap_skin 0.120367 no
DIF_gill_tissue YFB_cap_tissue 0.207399 no
DIF_gill_tissue YFB_gill_tissue 0.175781 no
DIF_gill_tissue YFB_veil 0.509653 no
YFB_stipe_center YFB_stipe_shell 0.649730 no
YFB_stipe_center YFB_stipe_skin 0.962170 no
YFB_stipe_center YFB_cap_skin 0.140702 no
YFB_stipe_center YFB_cap_tissue 0.294832 no
YFB_stipe_center YFB_gill_tissue 0.257376 no
YFB_stipe_center YFB_veil 0.663396 no
YFB_stipe_shell YFB_stipe_skin 0.725656 no
YFB_stipe_shell YFB_cap_skin 0.242331 no
YFB_stipe_shell YFB_cap_tissue 0.683175 no
YFB_stipe_shell YFB_gill_tissue 0.600946 no
YFB_stipe_shell YFB_veil 0.983962 no
YFB_stipe_skin YFB_cap_skin 0.148238 no
YFB_stipe_skin YFB_cap_tissue 0.364167 no
YFB_stipe_skin YFB_gill_tissue 0.318509 no
YFB_stipe_skin YFB_veil 0.745264 no
YFB_cap_skin YFB_cap_tissue 0.456665 no
YFB_cap_skin YFB_gill_tissue 0.540581 no
YFB_cap_skin YFB_veil 0.234408 no
YFB_cap_tissue YFB_gill_tissue 0.941234 no
YFB_cap_tissue YFB_veil 0.690337 no
YFB_gill_tissue YFB_veil 0.597567 no
Initials DIF_gill_tissue 0.228817 no
Initials YFB_stipe_center 0.088269 no
Initials YFB_stipe_shell 0.031323 yes
Initials YFB_stipe_skin 0.094657 no
Initials YFB_cap_skin 0.061473 no
Initials YFB_cap_tissue 0.019169 yes
Initials YFB_gill_tissue 0.023676 yes
Initials YFB_veil 0.033211 yes
Initials Pileal_Stipeal_center 0.040723 yes
Initials Pileal_Stipeal_shell 0.055979 no
Initials DIF_stipe_center 0.039165 yes
Initials DIF_stipe_shell 0.030134 yes
Initials DIF_stipe_skin 0.098939 no
Initials DIF_cap_skin 0.053358 no
Initials DIF_cap_tissue 0.118854 no
Pileal_Stipeal_center DIF_gill_tissue 0.579754 no
Pileal_Stipeal_center YFB_stipe_center 0.750523 no
Pileal_Stipeal_center YFB_stipe_shell 0.940475 no
Pileal_Stipeal_center YFB_stipe_skin 0.820668 no
Pileal_Stipeal_center YFB_cap_skin 0.202200 no
Pileal_Stipeal_center YFB_cap_tissue 0.605549 no
Pileal_Stipeal_center YFB_gill_tissue 0.519091 no
Pileal_Stipeal_center YFB_veil 0.948446 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.926220 no
Pileal_Stipeal_center DIF_stipe_center 0.925699 no
Pileal_Stipeal_center DIF_stipe_shell 0.952723 no
Pileal_Stipeal_center DIF_stipe_skin 0.796467 no
Pileal_Stipeal_center DIF_cap_skin 0.986662 no
Pileal_Stipeal_center DIF_cap_tissue 0.803698 no
Pileal_Stipeal_shell DIF_gill_tissue 0.691530 no
Pileal_Stipeal_shell YFB_stipe_center 0.854907 no
Pileal_Stipeal_shell YFB_stipe_shell 0.848533 no
Pileal_Stipeal_shell YFB_stipe_skin 0.913543 no
Pileal_Stipeal_shell YFB_cap_skin 0.183056 no
Pileal_Stipeal_shell YFB_cap_tissue 0.475766 no
Pileal_Stipeal_shell YFB_gill_tissue 0.410243 no
Pileal_Stipeal_shell YFB_veil 0.862312 no
Pileal_Stipeal_shell DIF_stipe_center 0.836615 no
Pileal_Stipeal_shell DIF_stipe_shell 0.866813 no
Pileal_Stipeal_shell DIF_stipe_skin 0.890687 no
Pileal_Stipeal_shell DIF_cap_skin 0.945120 no
Pileal_Stipeal_shell DIF_cap_tissue 0.894043 no
DIF_stipe_center DIF_gill_tissue 0.483634 no
DIF_stipe_center YFB_stipe_center 0.638029 no
DIF_stipe_center YFB_stipe_shell 0.983844 no
DIF_stipe_center YFB_stipe_skin 0.719201 no
DIF_stipe_center YFB_cap_skin 0.261860 no
DIF_stipe_center YFB_cap_tissue 0.734491 no
DIF_stipe_center YFB_gill_tissue 0.649255 no
DIF_stipe_center YFB_veil 0.981705 no
DIF_stipe_center DIF_stipe_shell 0.973827 no
DIF_stipe_center DIF_stipe_skin 0.691822 no
DIF_stipe_center DIF_cap_skin 0.906704 no
DIF_stipe_center DIF_cap_tissue 0.700459 no
DIF_stipe_shell DIF_gill_tissue 0.495567 no
DIF_stipe_shell YFB_stipe_center 0.665794 no
DIF_stipe_shell YFB_stipe_shell 0.983681 no
DIF_stipe_shell YFB_stipe_skin 0.748374 no
DIF_stipe_shell YFB_cap_skin 0.239210 no
DIF_stipe_shell YFB_cap_tissue 0.669319 no
DIF_stipe_shell YFB_gill_tissue 0.581553 no
DIF_stipe_shell YFB_veil 0.984744 no
DIF_stipe_shell DIF_stipe_skin 0.719604 no
DIF_stipe_shell DIF_cap_skin 0.935910 no
DIF_stipe_shell DIF_cap_tissue 0.726861 no
DIF_stipe_skin DIF_gill_tissue 0.845991 no
DIF_stipe_skin YFB_stipe_center 0.977706 no
DIF_stipe_skin YFB_stipe_shell 0.703088 no
DIF_stipe_skin YFB_stipe_skin 0.987667 no
DIF_stipe_skin YFB_cap_skin 0.146459 no
DIF_stipe_skin YFB_cap_tissue 0.343626 no
DIF_stipe_skin YFB_gill_tissue 0.296400 no
DIF_stipe_skin YFB_veil 0.721010 no
DIF_stipe_skin DIF_cap_skin 0.825568 no
DIF_stipe_skin DIF_cap_tissue 0.988282 no
DIF_cap_skin DIF_gill_tissue 0.618223 no
DIF_cap_skin YFB_stipe_center 0.776537 no
DIF_cap_skin YFB_stipe_shell 0.922260 no
DIF_cap_skin YFB_stipe_skin 0.847632 no
DIF_cap_skin YFB_cap_skin 0.203637 no
DIF_cap_skin YFB_cap_tissue 0.586070 no
DIF_cap_skin YFB_gill_tissue 0.504690 no
DIF_cap_skin YFB_veil 0.932469 no
DIF_cap_skin DIF_cap_tissue 0.825472 no
DIF_cap_tissue DIF_gill_tissue 0.849818 no
DIF_cap_tissue YFB_stipe_center 0.978298 no
DIF_cap_tissue YFB_stipe_shell 0.712426 no
DIF_cap_tissue YFB_stipe_skin 0.987947 no
DIF_cap_tissue YFB_cap_skin 0.147418 no
DIF_cap_tissue YFB_cap_tissue 0.361779 no
DIF_cap_tissue YFB_gill_tissue 0.310882 no
DIF_cap_tissue YFB_veil 0.730088 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029430
MVFSSSSFTLLTLFIVISTVCARPQSYAIWAADSGIQRQQGNGLGGDGNPDVSYEHGEFQWGLRQLYERTGEEKY
FEYIKNGVDNIVFGNGTVHGNYRLSDFSLDPVRTGPSFLYLLEKTGERKYQIAADVFKSQLDSHPRTAQGQFWHK
LRYPNQGWLDGIYMGDIFYADYTKRFQPDNTTAWDDIAKQFTLMYQNALQNATAPNNLHLLYHGYDFSHQKVWAS
PDRGHSPEIIQDINLSCRFYKTLYLTSEMPRILLLEFGG*
Coding >AgabiH97|029430
ATGGTCTTCTCATCATCAAGTTTTACACTGCTCACACTTTTCATAGTCATATCCACTGTTTGTGCTCGTCCACAG
TCTTATGCCATATGGGCAGCCGACTCGGGTATACAGCGACAGCAAGGAAATGGTCTTGGTGGGGATGGGAATCCT
GATGTATCTTATGAGCATGGAGAGTTTCAGTGGGGGTTGAGACAACTTTATGAAAGAACGGGGGAGGAGAAGTAT
TTTGAGTATATAAAAAACGGGGTGGATAATATTGTTTTTGGGAATGGGACTGTGCATGGGAATTATAGGTTGAGC
GATTTTAGTCTTGACCCGGTAAGAACCGGTCCTTCGTTCCTTTATCTTCTCGAAAAAACGGGTGAAAGGAAATAT
CAAATCGCCGCGGATGTATTCAAATCCCAACTGGATTCTCATCCCCGTACGGCTCAAGGACAGTTTTGGCATAAA
CTCAGATATCCGAATCAAGGTTGGCTTGATGGGATATATATGGGTGATATTTTCTATGCGGATTATACGAAACGA
TTCCAACCAGATAATACTACAGCTTGGGATGATATCGCGAAACAATTCACTTTGATGTATCAAAACGCCCTTCAA
AATGCTACTGCACCCAATAACCTCCATCTCTTATATCATGGATACGATTTTTCTCATCAAAAAGTATGGGCATCC
CCAGATAGAGGTCATTCACCTGAAATCATCCAGGATATCAATCTATCTTGTCGATTTTACAAGACATTGTACCTC
ACATCCGAGATGCCGCGGATCCTTCTACTGGAGTTTGGTGGTTAG
Transcript >AgabiH97|029430
ATGGTCTTCTCATCATCAAGTTTTACACTGCTCACACTTTTCATAGTCATATCCACTGTTTGTGCTCGTCCACAG
TCTTATGCCATATGGGCAGCCGACTCGGGTATACAGCGACAGCAAGGAAATGGTCTTGGTGGGGATGGGAATCCT
GATGTATCTTATGAGCATGGAGAGTTTCAGTGGGGGTTGAGACAACTTTATGAAAGAACGGGGGAGGAGAAGTAT
TTTGAGTATATAAAAAACGGGGTGGATAATATTGTTTTTGGGAATGGGACTGTGCATGGGAATTATAGGTTGAGC
GATTTTAGTCTTGACCCGGTAAGAACCGGTCCTTCGTTCCTTTATCTTCTCGAAAAAACGGGTGAAAGGAAATAT
CAAATCGCCGCGGATGTATTCAAATCCCAACTGGATTCTCATCCCCGTACGGCTCAAGGACAGTTTTGGCATAAA
CTCAGATATCCGAATCAAGGTTGGCTTGATGGGATATATATGGGTGATATTTTCTATGCGGATTATACGAAACGA
TTCCAACCAGATAATACTACAGCTTGGGATGATATCGCGAAACAATTCACTTTGATGTATCAAAACGCCCTTCAA
AATGCTACTGCACCCAATAACCTCCATCTCTTATATCATGGATACGATTTTTCTCATCAAAAAGTATGGGCATCC
CCAGATAGAGGTCATTCACCTGAAATCATCCAGGATATCAATCTATCTTGTCGATTTTACAAGACATTGTACCTC
ACATCCGAGATGCCGCGGATCCTTCTACTGGAGTTTGGTGGTTAG
Gene >AgabiH97|029430
ATGGTCTTCTCATCATCAAGTTTTACACTGCTCACACTTTTCATAGTCATATCCACTGTTTGTGCTCGTCCACAG
TCTTATGCCATATGGGCAGCCGACTCGGGTATACAGCGACAGCAAGGAAATGGTCTTGGTGGGGATGGGAATCCT
GATGTATCTTATGAGCATGGAGAGTTTCAGTGGGGGTTGAGACAACTTTATGAAAGAACGGGGGAGGAGAAGTAT
TTTGAGTATATAAAAAACGGGGTGGATAATATTGTTTTTGGGAATGGGACTGTGCATGGGAATTATAGGTGTGTT
TTTTTAGCTTGTCGGAGGAAGATTTAGTTGCTTTTTTTTTTTACTTGGTGTTTAGGTTGAGCGATTTTAGTCTTG
ACCCGGTAAGGTGAGCTTGATTTATATGCGAATGTTTTTTTTTTCGAATACCGAACTCATTTGACTTATAGAACC
GGTCCTTCGTTCCTTTATCTGTAAGCCATTTTCATAGCCCTTCCTATCCTTTGTATAGGGCTCAAAGTCCTTTCT
CTTTCTTTTCTTTTCTTTTCTTTTGTAGTCTCGAAAAAACGGGTGAAAGGAAATATCAAATCGCCGCGGATGTAT
TCAAATCCCAACTGGATTCTCATCCCCGTACGGCTCAAGGACAGTTTTGGCATAAACTCAGATATCCGAATCAAG
GTGCGCATTTGGGAAGAAAGGAAAAGAAAAGGATTAACTGGCTTTTTTTTTTGATTATAGGTTGGCTTGATGGGA
TATATATGGGTGATATTTTCTATGCGGATTATACGAAACGATTCCAACCAGATAATACTACAGCTTGGGGTACGA
ACTTCTTTCTTTTCTTTTTACTTTTCTATTAAAGTGCGAAATAGATGATATCGCGAAACAATTCACTTTGATGTA
TCAAAACGCCCTTCAAAATGCTACTGCACCCAATAACCTCCATCTCTTATATCATGGATACGATTTTTCTCATCA
AAAAGTATGGGCATCCCCAGATAGAGGTCATTCACCTGAAGTTTGGGATCGCGCTTTGGGATGGTTTTCAATGGC
TCTCGTCGACATTCTTGAAACATTCCCACAAGATCATCCAGGATATCAATCTATCTTGTCGATTTTACAAGACAT
TGTACCTCACATCCGAGATGCCGCGGATCCTTCTACTGGAGTTTGGTGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail