Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029390
Gene name
Locationscaffold_12:333071..334419
Strand-
Gene length (bp)1348
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 2.3E-46 67 281

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 12 376 2.0E-155
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 52 279 6.0E-84
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 69 274 5.0E-16

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 15.26 7.78 22.73
Initials Initials knots 26.49 14.57 38.40
Pileal_Stipeal_center Stage I stipe center 40.89 21.71 60.07
Pileal_Stipeal_shell Stage I stipe shell 18.75 9.86 27.65
DIF_stipe_center Stage II stipe center 2.48 0.90 4.07
DIF_stipe_shell Stage II stipe shell 6.38 2.87 9.89
DIF_stipe_skin Stage II stipe skin 25.56 13.82 37.29
DIF_cap_skin Stage II cap skin 7.05 3.22 10.89
DIF_cap_tissue Stage II cap tissue 6.67 2.85 10.49
DIF_gill_tissue Stage II gill tissue 12.72 6.08 19.35
YFB_stipe_center Young fruiting body stipe center 2.12 0.75 3.49
YFB_stipe_shell Young fruiting body stipe shell 2.01 0.69 3.33
YFB_stipe_skin Young fruiting body stipe skin 21.34 10.51 32.17
YFB_cap_skin Young fruiting body cap skin 2.60 0.93 4.28
YFB_cap_tissue Young fruiting body cap tissue 2.52 0.93 4.11
YFB_gill_tissue Young fruiting body gill tissue 6.07 2.71 9.42
YFB_veil Young fruiting body veil 10.83 5.30 16.36

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.730504 no
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.405210 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.007439 yes
Casing YFB_veil 0.389694 no
Casing Initials 0.089641 no
Casing Pileal_Stipeal_center 0.001140 yes
Casing Pileal_Stipeal_shell 0.656338 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.010093 yes
Casing DIF_stipe_skin 0.125142 no
Casing DIF_cap_skin 0.026215 yes
Casing DIF_cap_tissue 0.014081 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.160121 no
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.041603 yes
DIF_gill_tissue YFB_veil 0.778305 no
YFB_stipe_center YFB_stipe_shell 0.953385 no
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.767889 no
YFB_stipe_center YFB_cap_tissue 0.811782 no
YFB_stipe_center YFB_gill_tissue 0.008791 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.687700 no
YFB_stipe_shell YFB_cap_tissue 0.736051 no
YFB_stipe_shell YFB_gill_tissue 0.004928 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.037818 yes
YFB_cap_skin YFB_cap_tissue 0.970661 no
YFB_cap_skin YFB_gill_tissue 0.035309 yes
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.025963 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.109929 no
Initials DIF_gill_tissue 0.024444 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.630417 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.002084 yes
Initials Pileal_Stipeal_center 0.200673 no
Initials Pileal_Stipeal_shell 0.344495 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.954523 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.047584 yes
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.012274 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.175019 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.335521 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.813923 no
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.001625 yes
Pileal_Stipeal_shell YFB_veil 0.106196 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.428009 no
Pileal_Stipeal_shell DIF_cap_skin 0.003765 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.002084 yes
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.829112 no
DIF_stipe_center YFB_stipe_shell 0.755629 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.956407 no
DIF_stipe_center YFB_cap_tissue 0.986496 no
DIF_stipe_center YFB_gill_tissue 0.022892 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.016949 yes
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.007782 yes
DIF_stipe_center DIF_cap_tissue 0.012577 yes
DIF_stipe_shell DIF_gill_tissue 0.062038 no
DIF_stipe_shell YFB_stipe_center 0.004928 yes
DIF_stipe_shell YFB_stipe_shell 0.002525 yes
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.023676 yes
DIF_stipe_shell YFB_cap_tissue 0.017226 yes
DIF_stipe_shell YFB_gill_tissue 0.945095 no
DIF_stipe_shell YFB_veil 0.157580 no
DIF_stipe_shell DIF_stipe_skin 0.000613 yes
DIF_stipe_shell DIF_cap_skin 0.879428 no
DIF_stipe_shell DIF_cap_tissue 0.951369 no
DIF_stipe_skin DIF_gill_tissue 0.035076 yes
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.714310 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.002525 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.122909 no
DIF_cap_skin YFB_stipe_center 0.002084 yes
DIF_cap_skin YFB_stipe_shell 0.001140 yes
DIF_cap_skin YFB_stipe_skin 0.001140 yes
DIF_cap_skin YFB_cap_skin 0.011041 yes
DIF_cap_skin YFB_cap_tissue 0.008791 yes
DIF_cap_skin YFB_gill_tissue 0.808781 no
DIF_cap_skin YFB_veil 0.287492 no
DIF_cap_skin DIF_cap_tissue 0.940086 no
DIF_cap_tissue DIF_gill_tissue 0.087080 no
DIF_cap_tissue YFB_stipe_center 0.002951 yes
DIF_cap_tissue YFB_stipe_shell 0.002084 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.020790 yes
DIF_cap_tissue YFB_cap_tissue 0.015529 yes
DIF_cap_tissue YFB_gill_tissue 0.892437 no
DIF_cap_tissue YFB_veil 0.217648 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029390
MARLSSFIVLAIALVSSTTAFPAYQSLGGLSQRQIDSIMPGLKAVKPKDPPPPLKDNGTKLVNDAKHPWKPLRDG
DKRGPCPGLNTLASHGWLPRDGVATPQQIIAASQEGFNFESQIARRFTYSSHLIDGNLVTDLLSIGAKTDKTGPD
PPAPANPGGLNLHGVIEGDASMTRGDAYWGDNWHFNETQFSELLEFMDKYGDGLYNYKVAGEFRYQRIQESIATN
PEFNFTGGRFFAAYIETVVGANLFSDGRRNDSQVPADAARGFFQDSRMPDDFHRAARPFSTEGVEVVIGAHPFSP
GRNVNGINTYTIDPNSPTFESDADGCAQYEMFVNEAVVPLYPNPTGVLRRNLKINLQHYFDTFGGKCKQLFPYGR
DH*
Coding >AgabiH97|029390
ATGGCTCGCCTTTCATCCTTCATTGTCCTCGCTATTGCTCTGGTTTCTTCGACCACGGCTTTCCCTGCCTATCAA
TCCCTGGGAGGGCTGTCGCAAAGGCAGATAGATTCAATCATGCCTGGCCTTAAAGCAGTCAAGCCAAAGGACCCG
CCACCTCCTTTGAAGGACAACGGAACTAAACTCGTCAATGATGCCAAACATCCTTGGAAGCCCCTCCGAGACGGT
GATAAGCGAGGGCCTTGTCCCGGATTGAATACTCTTGCTTCGCATGGTTGGTTGCCGCGTGATGGTGTTGCAACA
CCACAACAAATCATCGCTGCCTCTCAAGAAGGATTCAATTTCGAGAGTCAGATCGCAAGGAGATTTACATATTCC
AGTCATCTCATTGACGGAAACCTTGTCACCGATCTGCTCAGTATTGGCGCGAAGACTGATAAGACTGGTCCTGAT
CCACCTGCCCCAGCAAACCCCGGTGGCCTCAACTTACATGGAGTAATTGAAGGCGACGCCAGCATGACCCGAGGT
GATGCATACTGGGGTGACAATTGGCACTTCAACGAGACCCAGTTCTCAGAGCTCCTTGAATTCATGGATAAATAC
GGAGATGGACTCTACAACTACAAGGTCGCCGGTGAATTCAGATACCAGCGTATCCAAGAGTCCATTGCGACGAAC
CCGGAATTTAACTTCACCGGCGGTCGCTTTTTCGCTGCATACATCGAAACGGTCGTCGGAGCCAACTTGTTCTCT
GATGGACGCCGGAACGACAGTCAAGTTCCCGCCGACGCTGCACGCGGCTTTTTCCAAGACTCGCGCATGCCTGAT
GACTTCCACAGAGCCGCCAGGCCGTTCAGCACAGAAGGTGTTGAAGTTGTCATTGGTGCCCACCCCTTCTCTCCG
GGTCGTAACGTCAACGGAATCAACACATACACCATCGACCCCAATTCTCCCACTTTCGAGTCCGACGCGGATGGC
TGTGCGCAGTATGAGATGTTTGTGAATGAGGCCGTCGTTCCTTTGTATCCCAACCCGACTGGGGTGCTAAGGAGG
AATTTGAAAATCAACTTACAACACTACTTTGATACTTTTGGTGGTAAATGCAAGCAGCTATTCCCTTACGGAAGA
GATCATTAG
Transcript >AgabiH97|029390
ATGGCTCGCCTTTCATCCTTCATTGTCCTCGCTATTGCTCTGGTTTCTTCGACCACGGCTTTCCCTGCCTATCAA
TCCCTGGGAGGGCTGTCGCAAAGGCAGATAGATTCAATCATGCCTGGCCTTAAAGCAGTCAAGCCAAAGGACCCG
CCACCTCCTTTGAAGGACAACGGAACTAAACTCGTCAATGATGCCAAACATCCTTGGAAGCCCCTCCGAGACGGT
GATAAGCGAGGGCCTTGTCCCGGATTGAATACTCTTGCTTCGCATGGTTGGTTGCCGCGTGATGGTGTTGCAACA
CCACAACAAATCATCGCTGCCTCTCAAGAAGGATTCAATTTCGAGAGTCAGATCGCAAGGAGATTTACATATTCC
AGTCATCTCATTGACGGAAACCTTGTCACCGATCTGCTCAGTATTGGCGCGAAGACTGATAAGACTGGTCCTGAT
CCACCTGCCCCAGCAAACCCCGGTGGCCTCAACTTACATGGAGTAATTGAAGGCGACGCCAGCATGACCCGAGGT
GATGCATACTGGGGTGACAATTGGCACTTCAACGAGACCCAGTTCTCAGAGCTCCTTGAATTCATGGATAAATAC
GGAGATGGACTCTACAACTACAAGGTCGCCGGTGAATTCAGATACCAGCGTATCCAAGAGTCCATTGCGACGAAC
CCGGAATTTAACTTCACCGGCGGTCGCTTTTTCGCTGCATACATCGAAACGGTCGTCGGAGCCAACTTGTTCTCT
GATGGACGCCGGAACGACAGTCAAGTTCCCGCCGACGCTGCACGCGGCTTTTTCCAAGACTCGCGCATGCCTGAT
GACTTCCACAGAGCCGCCAGGCCGTTCAGCACAGAAGGTGTTGAAGTTGTCATTGGTGCCCACCCCTTCTCTCCG
GGTCGTAACGTCAACGGAATCAACACATACACCATCGACCCCAATTCTCCCACTTTCGAGTCCGACGCGGATGGC
TGTGCGCAGTATGAGATGTTTGTGAATGAGGCCGTCGTTCCTTTGTATCCCAACCCGACTGGGGTGCTAAGGAGG
AATTTGAAAATCAACTTACAACACTACTTTGATACTTTTGGTGGTAAATGCAAGCAGCTATTCCCTTACGGAAGA
GATCATTAG
Gene >AgabiH97|029390
ATGGCTCGCCTTTCATCCTTCATTGTCCTCGCTATTGCTCTGGTTTCTTCGACCACGGCTTTCCCTGCCTATCAA
TCCCTGGGAGGGCTGTCGCAAAGGCAGATAGATTCAATCATGCCTGGCCTTAAAGCAGTCAAGCCAAAGGACCCG
CCACCTCCTTTGAAGGACAACGGAACTAAACTCGTCAATGATGCCAAACATCCTTGGAAGCCCCTCCGAGACGGT
GATAAGCGAGGGCCTTGTCCCGGATTGAATACTCTTGCTTCGCATGGTGTAAGCTCCAGCACTATATGAGTTAGG
AATCTGACCTTGACTAAACCCATAGTGGTTGCCGCGTGATGGTGTTGCAACACCACAACAAATCATCGCTGCCTC
TCAAGAAGGTGAGGATCGGTCGTTCTTCTGTACTTCAATTGCAAAATCTTACCTCGTTATAGGATTCAATTTCGA
GAGTCAGATCGCAAGGAGATTTACATATTCCAGTCATCTCATTGACGGAAACCTTGTCACCGATCTGCTCAGTAT
TGGCGCGAAGACTGATAAGACTGGTCCTGATCCACCTGCCCCAGCAAACCCCGGTGGCCTCAACTTACATGGAGT
AATTGAAGGCGACGCCAGCATGACCCGAGGTACGTGTGAACGAGACATTTCGCAGTAAAGCTAACGTGTCTCTGA
TGAACAGGTGATGCATACTGGGGTGACAATTGGCACTTCAACGAGACCCAGTTCTCAGAGGTAAATAGTCAACCC
CAAGCTACAAAAGAATACCAACGACTTACCTGGGCAATAGCTCCTTGAATTCATGGATAAATACGGAGATGGACT
CTACAACTACAAGGTCGCCGGTGAATTCAGATACCAGCGTATCCAAGAGTCCATTGCGACGAACCCGGAATTTAA
CTTCACCGGCGGTCGCTTTTTCGCTGCATACATCGAAACGGTCGTCGGAGCCAACTTGTTCTCTGATGGACGCCG
GAACGACAGTCAAGTTCCCGCCGACGCTGCACGCGGCTTTTTCCAAGACTCGCGCATGCCTGATGACTTCCACAG
AGCCGCCAGGCCGTTCAGCACAGAAGGTGTTGAAGTTGTCATTGGTGCCCACCCCTTCTCTCCGGGTCGTAACGT
CAACGGAATCAACACATACACCATCGACCCCAATTCTCCCACTTTCGAGTCCGACGCGGATGGCTGTGCGCAGTA
TGAGATGTTTGTGAATGAGGCCGTCGTTCCTTTGTATCCCAACCCGACTGGGGTGCTAAGGAGGAATTTGAAAAT
CAACTTACAACACTACTTTGATACTTTTGGTGGTAAATGCAAGCAGCTATTCCCTTACGGAAGAGATCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail