Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029350
Gene name
Locationscaffold_12:324506..326235
Strand-
Gene length (bp)1729
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 2.2E-18 45 153
PF13649 Methyltransf_25 Methyltransferase domain 6.1E-15 45 149
PF13847 Methyltransf_31 Methyltransferase domain 4.7E-11 43 150
PF08242 Methyltransf_12 Methyltransferase domain 5.8E-10 45 150
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 8.1E-05 39 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZRD1|TMT1_YEAS7 Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=TMT1 PE=3 SV=1 1 279 1.0E-27
sp|P32643|TMT1_YEAST Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMT1 PE=1 SV=1 1 279 1.0E-27
sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRG1 PE=1 SV=1 2 282 5.0E-22
sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 14 263 2.0E-15
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 14 186 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZRD1|TMT1_YEAS7 Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=TMT1 PE=3 SV=1 1 279 1.0E-27
sp|P32643|TMT1_YEAST Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMT1 PE=1 SV=1 1 279 1.0E-27
sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRG1 PE=1 SV=1 2 282 5.0E-22
sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 14 263 2.0E-15
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 14 186 6.0E-12
sp|P9WK01|Y3342_MYCTU Uncharacterized methyltransferase Rv3342 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3342 PE=1 SV=1 14 186 6.0E-12
sp|P9WK00|Y3342_MYCTO Uncharacterized methyltransferase MT3445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3445 PE=3 SV=1 14 186 6.0E-12
sp|Q9UTA9|YL89_SCHPO Uncharacterized methyltransferase C25B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.09 PE=3 SV=1 14 171 4.0E-09
sp|Q9UTA8|YL8A_SCHPO Uncharacterized methyltransferase-like C25B8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.10 PE=3 SV=1 14 171 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029350
MATFAKSTYNASFYSASRPNYPKKLFKHIFDHHRRHPDAKWERAVDLGCGTGQATRHLSYALFHEIIGLDPSANM
IKTANRDFFPGVNATSVSSIAHTQFEFRRGSAEDLKSAGIEDKSVDMVIAAQACHWFDWNKVWPEIDRVLRVGGT
AAFWVYSEFRLPWYPSLTPMITAFAQGKGKDHDPVNSLGSYFERPGRTILENHLLDVPSCESVLGESTTLIEDRV
YFAGNYHPQTLPQTHTLPIIMRKRMTWRDLLGYFRTWSSLHKYHEVYPEDKTRKPDIRFLEEDVAAVGPLGPGDV
DVTGGDIAVRFWKNLRCGVRDEAMSLDVKVGVNDIVLVEWPVALILVNKM*
Coding >AgabiH97|029350
ATGGCTACTTTTGCCAAATCCACGTACAACGCGTCATTCTATTCCGCTTCTCGTCCAAACTACCCCAAAAAACTT
TTTAAACACATTTTTGATCATCATCGGCGGCACCCAGATGCGAAGTGGGAGCGCGCGGTAGACCTAGGATGTGGA
ACTGGCCAAGCCACTAGACACCTCAGTTACGCATTATTCCATGAAATCATTGGTCTTGATCCGTCAGCGAATATG
ATCAAGACAGCGAATCGTGATTTCTTTCCGGGTGTCAATGCTACTTCCGTTTCGAGCATTGCACATACCCAGTTT
GAGTTTAGACGTGGCAGCGCGGAGGATTTGAAGAGTGCTGGAATTGAGGATAAGAGCGTTGATATGGTCATTGCT
GCGCAAGCTTGCCATTGGTTTGATTGGAATAAAGTATGGCCTGAGATAGATAGGGTTTTGAGAGTCGGGGGTACA
GCTGCATTTTGGGTATATTCGGAATTCCGATTACCTTGGTATCCTTCGTTGACACCTATGATAACGGCTTTTGCT
CAAGGTAAAGGTAAAGATCATGATCCGGTGAATAGTTTAGGATCATATTTTGAGAGGCCGGGAAGGACGATACTT
GAGAACCATTTGTTGGATGTCCCGTCTTGTGAGAGTGTTTTGGGAGAGAGTACGACCTTGATCGAGGACAGGGTT
TATTTTGCTGGTAATTACCACCCTCAAACCCTGCCACAAACTCATACTCTACCCATAATCATGCGTAAAAGAATG
ACTTGGCGTGATTTATTAGGATACTTCCGAACTTGGAGCTCATTACACAAGTATCATGAAGTGTATCCTGAAGAT
AAAACAAGGAAGCCTGATATCCGGTTTTTGGAAGAGGATGTAGCGGCTGTAGGGCCTTTGGGGCCGGGTGATGTG
GATGTGACGGGAGGGGATATTGCGGTACGGTTTTGGAAGAATTTGAGGTGTGGTGTGAGGGATGAGGCGATGTCT
TTGGATGTGAAGGTGGGGGTGAATGATATTGTGCTTGTGGAATGGCCCGTGGCTTTGATTTTGGTGAATAAGATG
TGA
Transcript >AgabiH97|029350
ATGGCTACTTTTGCCAAATCCACGTACAACGCGTCATTCTATTCCGCTTCTCGTCCAAACTACCCCAAAAAACTT
TTTAAACACATTTTTGATCATCATCGGCGGCACCCAGATGCGAAGTGGGAGCGCGCGGTAGACCTAGGATGTGGA
ACTGGCCAAGCCACTAGACACCTCAGTTACGCATTATTCCATGAAATCATTGGTCTTGATCCGTCAGCGAATATG
ATCAAGACAGCGAATCGTGATTTCTTTCCGGGTGTCAATGCTACTTCCGTTTCGAGCATTGCACATACCCAGTTT
GAGTTTAGACGTGGCAGCGCGGAGGATTTGAAGAGTGCTGGAATTGAGGATAAGAGCGTTGATATGGTCATTGCT
GCGCAAGCTTGCCATTGGTTTGATTGGAATAAAGTATGGCCTGAGATAGATAGGGTTTTGAGAGTCGGGGGTACA
GCTGCATTTTGGGTATATTCGGAATTCCGATTACCTTGGTATCCTTCGTTGACACCTATGATAACGGCTTTTGCT
CAAGGTAAAGGTAAAGATCATGATCCGGTGAATAGTTTAGGATCATATTTTGAGAGGCCGGGAAGGACGATACTT
GAGAACCATTTGTTGGATGTCCCGTCTTGTGAGAGTGTTTTGGGAGAGAGTACGACCTTGATCGAGGACAGGGTT
TATTTTGCTGGTAATTACCACCCTCAAACCCTGCCACAAACTCATACTCTACCCATAATCATGCGTAAAAGAATG
ACTTGGCGTGATTTATTAGGATACTTCCGAACTTGGAGCTCATTACACAAGTATCATGAAGTGTATCCTGAAGAT
AAAACAAGGAAGCCTGATATCCGGTTTTTGGAAGAGGATGTAGCGGCTGTAGGGCCTTTGGGGCCGGGTGATGTG
GATGTGACGGGAGGGGATATTGCGGTACGGTTTTGGAAGAATTTGAGGTGTGGTGTGAGGGATGAGGCGATGTCT
TTGGATGTGAAGGTGGGGGTGAATGATATTGTGCTTGTGGAATGGCCCGTGGCTTTGATTTTGGTGAATAAGATG
TGA
Gene >AgabiH97|029350
ATGGCTACTTTTGCCAAATCCACGTACAACGCGTCATTCTATTCCGCTTCTCGTCCAAACTACCCCAAAAAACTT
TTTAAACACATTTTTGATCATCATCGGCGGCACCCAGATGCGAAGTGGGAGCGCGCGGTAGACCTAGGATGTGGA
ACTGGTACTGATACATCATTCGTCTCACCATTGTGCTTAGTGGAATTTCGACTTTAGGCCAAGCCACTAGACACC
TCAGTTACGCATTATTCCATGAAATCATTGGTCTTGATCCGTCAGCGAATATGATCAAGACAGCGAATCGTGATT
TCTTTCCGGGTGTCAATGCTACTTCCGTTTCGAGCATTGCACATACCCAGTTTGAGTTTAGACGTGGCAGCGCGG
AGGATTTGAAGAGTGCTGGAATTGAGGATAAGAGCGTTGATATGGTCATTGCTGGTCAGTCTTCCTTTAGGTTGT
TCACCTTAATCTTCGTTCGCCTTTAACTGATGAGTTGGATGGGATATCTCCGTGGATCTTTTCTTCCCTTTCTTT
TCTTTTGGCTTTCTGCGTTACGGCTCTGTCCATACGTTTTTGCGCGGCATGGTTTTGTGCTTTCTTCTCGTCTGC
GACTGACCTATGTTTAGCGCAAGCTTGCCATTGGTTTGATTGGAATAAAGTATGGCCTGAGATAGATAGGGTTTT
GAGAGTCGGGGGTACAGCTGCATTTTGGGTATGTGATTCATCATTTTTCAAAAAAAAGACTTCTTCTTTTACTTT
CTTTCTTACCCTTTCATATCTTGAGAAAGGAAATGTTCTGACGTTGTTCTTCTCTTCTTCTTCTTTTCATATTTT
TCCAGGTATATTCGGAATTCCGATTACCTTGGTATCCTTCGTTGACACCTATGATAACGGCTTTTGCTCAAGGTA
AAGGTAAAGATCATGATCCGGTGAATAGTTTAGGATCATATTTTGAGAGGCCGGGAAGGACGATACTTGAGAACC
ATTTGTTGGATGTCCCGTCTTGTGAGAGTGTTTTGGGAGAGAGTACGACCTTGATCGAGGACAGGGTTTATTTTG
CTGGTGAGTTTTTTCTTTTCTTTTCTTTTTGTTTTTGGATAGACAGATGTTCTTATTTGGTTGTTTCTCATGTCG
TATTTGATTTGAGTAACGACCAGGGTGATAGAAGCTCGCTCTTCTACCGAACGATGGTTTCCGGGTGAATGGAAG
AGAACGCGGGTTTTAAGGATGGAACTATAGCCGTATAAGAGCTTAAACTTTCTCTCTTTTTTCCTCGGCTTGCAC
TAAAAACCCTCCGTCTTCCATTCTCATTCCTTTCTCAATAAACTCGCCACTAACGTTTTTTCTCTCTCTCATCTT
CCCTACAACAGGTAATTACCACCCTCAAACCCTGCCACAAACTCATACTCTACCCATAATCATGCGTAAAAGAAT
GACTTGGCGTGATTTATTAGGATACTTCCGAACTTGGAGCTCATTACACAAGTATCATGAAGTGTATCCTGAAGA
TAAAACAAGGAAGCCTGATATCCGGTTTTTGGAAGAGGATGTAGCGGCTGTAGGGCCTTTGGGGCCGGGTGATGT
GGATGTGACGGGAGGGGATATTGCGGTACGGTTTTGGAAGAATTTGAGGTGTGGTGTGAGGGATGAGGCGATGTC
TTTGGATGTGAAGGTGGGGGTGAATGATATTGTGCTTGTGGAATGGCCCGTGGCTTTGATTTTGGTGAATAAGAT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail