Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029340
Gene name
Locationscaffold_12:323184..323694
Strand-
Gene length (bp)510
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 7.2E-22 34 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 1 119 2.0E-77
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 27 119 7.0E-23
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 31 116 6.0E-19
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 32 116 6.0E-18
sp|P52749|HYP2_PISTI Hydrophobin-2 (Fragment) OS=Pisolithus tinctorius GN=HYD-2 PE=2 SV=1 29 118 9.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 1 119 2.0E-77
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 27 119 7.0E-23
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 31 116 6.0E-19
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 32 116 6.0E-18
sp|P52749|HYP2_PISTI Hydrophobin-2 (Fragment) OS=Pisolithus tinctorius GN=HYD-2 PE=2 SV=1 29 118 9.0E-16
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 27 119 2.0E-14
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 119 3.0E-13
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 31 116 1.0E-11
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 1 119 2.0E-10
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 27 119 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029340
MVSTFITVAKTLLVALLFVNINIVVGTATTGKHCSTGPIECCKQVMDSKSPQATELLTKNGLGLGVLAGVKGLVG
ANCSPITAIGIGSGSQCSGQTVCCQNNNFNGVVAIGCTPINANV*
Coding >AgabiH97|029340
ATGGTCTCAACGTTCATCACTGTAGCAAAAACCCTTCTCGTCGCGCTCCTCTTCGTCAATATCAATATCGTCGTT
GGTACTGCAACTACCGGAAAACATTGTAGCACCGGTCCTATAGAGTGTTGTAAACAAGTCATGGATTCTAAAAGT
CCTCAAGCTACGGAGTTGTTGACGAAAAATGGCCTTGGACTGGGTGTACTTGCTGGAGTGAAAGGTTTGGTTGGA
GCGAATTGTAGTCCTATCACGGCAATTGGTATTGGATCCGGAAGCCAATGTTCTGGACAGACCGTTTGTTGCCAA
AATAATAATTTCAACGGTGTTGTCGCTATTGGTTGTACTCCCATTAATGCCAATGTGTAA
Transcript >AgabiH97|029340
ATGGTCTCAACGTTCATCACTGTAGCAAAAACCCTTCTCGTCGCGCTCCTCTTCGTCAATATCAATATCGTCGTT
GGTACTGCAACTACCGGAAAACATTGTAGCACCGGTCCTATAGAGTGTTGTAAACAAGTCATGGATTCTAAAAGT
CCTCAAGCTACGGAGTTGTTGACGAAAAATGGCCTTGGACTGGGTGTACTTGCTGGAGTGAAAGGTTTGGTTGGA
GCGAATTGTAGTCCTATCACGGCAATTGGTATTGGATCCGGAAGCCAATGTTCTGGACAGACCGTTTGTTGCCAA
AATAATAATTTCAACGGTGTTGTCGCTATTGGTTGTACTCCCATTAATGCCAATGTGTAA
Gene >AgabiH97|029340
ATGGTCTCAACGTTCATCACTGTAGCAAAAACCCTTCTCGTCGCGCTCCTCTTCGTCAATATCAATATCGTCGTT
GGTACTGCAACTACCGGAAAACATTGTAGCACCGGTCCTATAGAGTGTTGTAAACAAGTCATGGATTCTAAAAGT
CCTCAAGCTACGGAGTTGTTGACGAAAAATGGCCTTGGACTGGGTGTACTTGCTGGAGTGAAAGGTTTGGTTGGA
GCGAATTGTAGTCCTATCACGGCAATTGGTATTGGATCCGGAAGCCAATGGTACGTTTTGGAATGGATTGATTTG
TTTCTGTGATTACGCTGGATGTTGATTAGCTCTTCCCCCCCCTTTTTTTTTTAGTTCTGGACAGACCGTTTGTTG
CCAAAATAATAATTTCAGTGAGACTGACCACCCTCTCTCTCTTTCTGAGCTTTTCCGCGGTTCGAATACTGATTT
ATCCTCTTTTCAGACGGTGTTGTCGCTATTGGTTGTACTCCCATTAATGCCAATGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail